Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PP_4151-4152/excise(antitoxin) |
Location | 2719914..2720956 | Replicon | chromosome |
Accession | NZ_CP104866 | ||
Organism | Pseudomonas aeruginosa strain PALA4 |
Toxin (Protein)
Gene name | PP_4152 | Uniprot ID | - |
Locus tag | PALA4_RS12825 | Protein ID | WP_003153636.1 |
Coordinates | 2720381..2720956 (+) | Length | 192 a.a. |
Antitoxin (Protein)
Gene name | PP_4151 | Uniprot ID | I3TV68 |
Locus tag | PALA4_RS12820 | Protein ID | WP_003050245.1 |
Coordinates | 2719914..2720384 (+) | Length | 157 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PALA4_RS12785 (PALA4_02533) | 2715297..2716727 | - | 1431 | WP_009516218.1 | TIGR03752 family integrating conjugative element protein | - |
PALA4_RS12790 (PALA4_02534) | 2716717..2717625 | - | 909 | WP_009516219.1 | TIGR03749 family integrating conjugative element protein | - |
PALA4_RS12795 (PALA4_02535) | 2717622..2718314 | - | 693 | WP_009516220.1 | TIGR03746 family integrating conjugative element protein | - |
PALA4_RS12800 (PALA4_02536) | 2718311..2718709 | - | 399 | WP_009516221.1 | TIGR03750 family conjugal transfer protein | - |
PALA4_RS12805 (PALA4_02537) | 2718721..2719080 | - | 360 | WP_003090173.1 | TIGR03745 family integrating conjugative element membrane protein | - |
PALA4_RS12810 (PALA4_02538) | 2719097..2719330 | - | 234 | WP_003050225.1 | TIGR03758 family integrating conjugative element protein | - |
PALA4_RS12815 (PALA4_02539) | 2719327..2719710 | - | 384 | WP_003090167.1 | RAQPRD family integrative conjugative element protein | - |
PALA4_RS12820 (PALA4_02540) | 2719914..2720384 | + | 471 | WP_003050245.1 | helix-turn-helix domain-containing protein | Antitoxin |
PALA4_RS12825 (PALA4_02541) | 2720381..2720956 | + | 576 | WP_003153636.1 | PIN domain-containing protein | Toxin |
PALA4_RS12830 (PALA4_02542) | 2720974..2721888 | + | 915 | WP_003050256.1 | AAA family ATPase | - |
PALA4_RS12835 (PALA4_02543) | 2721885..2722355 | + | 471 | WP_003090160.1 | type III CBASS phage resistance system CD-NTase-associated protein Cap8 | - |
PALA4_RS12840 (PALA4_02544) | 2722352..2722852 | + | 501 | WP_003090159.1 | type III CBASS phage resistance system CD-NTase-associated protein Cap7 | - |
PALA4_RS12845 (PALA4_02545) | 2722852..2723754 | + | 903 | WP_003090158.1 | CBASS oligonucleotide cyclase | - |
PALA4_RS12850 (PALA4_02546) | 2723793..2724518 | + | 726 | WP_003050273.1 | CBASS effector endonuclease NucC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | - | 2648114..2772559 | 124445 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 192 a.a. Molecular weight: 21629.78 Da Isoelectric Point: 5.9995
>T259402 WP_003153636.1 NZ_CP104866:2720381-2720956 [Pseudomonas aeruginosa]
MRHSPFTAVYDACVLYPAPLRDFLMWLGLSGRFRARWSQAIHEEWKRNLLINRPDLTRVQVDRTSDLMDRAIPDGLVEGY
EALVAGLTLPDPNDRHVLAAAIRCGASVIVTFNERDFPNDLLAPYGIESQHPDEFVDNLLDLDAAAVVSAAQRQRAQLKH
PPIDVDRYLEILLRQGLVQTTKVLATYRTIL
MRHSPFTAVYDACVLYPAPLRDFLMWLGLSGRFRARWSQAIHEEWKRNLLINRPDLTRVQVDRTSDLMDRAIPDGLVEGY
EALVAGLTLPDPNDRHVLAAAIRCGASVIVTFNERDFPNDLLAPYGIESQHPDEFVDNLLDLDAAAVVSAAQRQRAQLKH
PPIDVDRYLEILLRQGLVQTTKVLATYRTIL
Download Length: 576 bp
Antitoxin
Download Length: 157 a.a. Molecular weight: 17245.62 Da Isoelectric Point: 6.3803
>AT259402 WP_003050245.1 NZ_CP104866:2719914-2720384 [Pseudomonas aeruginosa]
MTTATAQSKMTLPAAGEVKAAVQGQRALAAYLATQFETQHIQIFDDHKQAHQVELPTSALRLLVDILAELADGNAVKVVP
VHAELTTQEAADLLNVSRPHFVKLLEDGVLAFHRTGKHRRVRFADLMQYKEARERASEQAMAELAQQSQELGMGYE
MTTATAQSKMTLPAAGEVKAAVQGQRALAAYLATQFETQHIQIFDDHKQAHQVELPTSALRLLVDILAELADGNAVKVVP
VHAELTTQEAADLLNVSRPHFVKLLEDGVLAFHRTGKHRRVRFADLMQYKEARERASEQAMAELAQQSQELGMGYE
Download Length: 471 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|