Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PfiT-PfiA/- |
Location | 4285670..4286265 | Replicon | chromosome |
Accession | NZ_CP104865 | ||
Organism | Pseudomonas aeruginosa strain PALA2 |
Toxin (Protein)
Gene name | PfiT | Uniprot ID | Q58CI8 |
Locus tag | PALA2_RS19870 | Protein ID | WP_004348413.1 |
Coordinates | 4285670..4286011 (-) | Length | 114 a.a. |
Antitoxin (Protein)
Gene name | PfiA | Uniprot ID | Q58CI7 |
Locus tag | PALA2_RS19875 | Protein ID | WP_004348412.1 |
Coordinates | 4286017..4286265 (-) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PALA2_RS19850 (PALA2_03953) | 4281663..4282814 | - | 1152 | WP_004348416.1 | thiolase | - |
PALA2_RS19855 (PALA2_03954) | 4282811..4283197 | - | 387 | WP_003086280.1 | OB-fold domain-containing protein | - |
PALA2_RS19860 (PALA2_03955) | 4283355..4284155 | + | 801 | WP_004348415.1 | IclR family transcriptional regulator | - |
PALA2_RS19865 (PALA2_03956) | 4284195..4285187 | - | 993 | WP_004348414.1 | 1,2-glucosyltransferase WapB | - |
PALA2_RS19870 (PALA2_03957) | 4285670..4286011 | - | 342 | WP_004348413.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PALA2_RS19875 (PALA2_03958) | 4286017..4286265 | - | 249 | WP_004348412.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
PALA2_RS19880 (PALA2_03959) | 4286366..4287640 | - | 1275 | WP_004348411.1 | hypothetical protein | - |
PALA2_RS19885 (PALA2_03961) | 4287878..4289027 | - | 1150 | Protein_3936 | hypothetical protein | - |
PALA2_RS19890 (PALA2_03962) | 4289031..4289387 | - | 357 | WP_004348407.1 | DUF2523 family protein | - |
PALA2_RS19895 (PALA2_03963) | 4289391..4290689 | - | 1299 | Protein_3938 | attachment protein | - |
PALA2_RS19900 (PALA2_03964) | 4290830..4291081 | - | 252 | WP_004348403.1 | major capsid protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 4284195..4300436 | 16241 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12942.62 Da Isoelectric Point: 4.5106
>T259394 WP_004348413.1 NZ_CP104865:c4286011-4285670 [Pseudomonas aeruginosa]
MTVREIRFTETAVFSIQDQEEHLADYHPPELAAAKIDGLIDEILTRLQDAPVGYPVSRQASDLGVTRYRELNHDGYRVLY
EAYEHENVIAVELVLRQKQDVEAALIRYCLVGI
MTVREIRFTETAVFSIQDQEEHLADYHPPELAAAKIDGLIDEILTRLQDAPVGYPVSRQASDLGVTRYRELNHDGYRVLY
EAYEHENVIAVELVLRQKQDVEAALIRYCLVGI
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|