Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/RHH(antitoxin) |
Location | 143486..143991 | Replicon | chromosome |
Accession | NZ_CP104865 | ||
Organism | Pseudomonas aeruginosa strain PALA2 |
Toxin (Protein)
Gene name | parE | Uniprot ID | V6A7K8 |
Locus tag | PALA2_RS00655 | Protein ID | WP_003083773.1 |
Coordinates | 143486..143767 (-) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | A0A1C7BDS9 |
Locus tag | PALA2_RS00660 | Protein ID | WP_003083775.1 |
Coordinates | 143764..143991 (-) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PALA2_RS00630 (PALA2_00124) | 138737..140086 | + | 1350 | WP_003119513.1 | C4-dicarboxylate transporter DctA | - |
PALA2_RS00635 (PALA2_00125) | 140135..140821 | + | 687 | WP_003083762.1 | FadR/GntR family transcriptional regulator | - |
PALA2_RS00640 (PALA2_00126) | 140922..141656 | + | 735 | WP_004346926.1 | GntR family transcriptional regulator | - |
PALA2_RS00645 (PALA2_00127) | 141836..142246 | + | 411 | WP_003101225.1 | aegerolysin family protein | - |
PALA2_RS00650 (PALA2_00128) | 142278..143186 | - | 909 | WP_003083769.1 | LysR family transcriptional regulator | - |
PALA2_RS00655 (PALA2_00129) | 143486..143767 | - | 282 | WP_003083773.1 | type II toxin-antitoxin system toxin ParE | Toxin |
PALA2_RS00660 (PALA2_00130) | 143764..143991 | - | 228 | WP_003083775.1 | CopG family ribbon-helix-helix protein | Antitoxin |
PALA2_RS00665 (PALA2_00131) | 144167..144787 | - | 621 | WP_003101226.1 | hypothetical protein | - |
PALA2_RS00670 (PALA2_00132) | 144888..145388 | + | 501 | WP_003112629.1 | LEA type 2 family protein | - |
PALA2_RS00675 (PALA2_00133) | 145461..145802 | + | 342 | WP_003101229.1 | zinc ribbon domain-containing protein YjdM | - |
PALA2_RS00680 (PALA2_00134) | 145884..147311 | - | 1428 | WP_003121620.1 | GABA permease | - |
PALA2_RS00685 (PALA2_00135) | 147480..148973 | - | 1494 | WP_003101230.1 | CoA-acylating methylmalonate-semialdehyde dehydrogenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10462.19 Da Isoelectric Point: 10.0435
>T259390 WP_003083773.1 NZ_CP104865:c143767-143486 [Pseudomonas aeruginosa]
MSLKWTRKAAADLDAIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
MSLKWTRKAAADLDAIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|