Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PumAB/upstrm_HI1419-dnstrm_HI1420 |
Location | 4571933..4572581 | Replicon | chromosome |
Accession | NZ_CP104863 | ||
Organism | Stenotrophomonas maltophilia strain CW002SM |
Toxin (Protein)
Gene name | PumA | Uniprot ID | B2FJ07 |
Locus tag | N0O74_RS21385 | Protein ID | WP_012478870.1 |
Coordinates | 4572294..4572581 (-) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | PumB | Uniprot ID | - |
Locus tag | N0O74_RS21380 | Protein ID | WP_012478871.1 |
Coordinates | 4571933..4572235 (-) | Length | 101 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N0O74_RS21350 (N0O74_21350) | 4566948..4567169 | - | 222 | WP_261728077.1 | CsbD family protein | - |
N0O74_RS21355 (N0O74_21355) | 4567377..4567514 | - | 138 | WP_005407710.1 | entericidin A/B family lipoprotein | - |
N0O74_RS21360 (N0O74_21360) | 4567675..4568562 | - | 888 | WP_261728512.1 | arginase | - |
N0O74_RS21365 (N0O74_21365) | 4568453..4570408 | - | 1956 | WP_261728078.1 | DUF3011 domain-containing protein | - |
N0O74_RS21370 (N0O74_21370) | 4571065..4571472 | + | 408 | WP_044569408.1 | hypothetical protein | - |
N0O74_RS21375 (N0O74_21375) | 4571552..4571875 | + | 324 | WP_012478872.1 | hypothetical protein | - |
N0O74_RS21380 (N0O74_21380) | 4571933..4572235 | - | 303 | WP_012478871.1 | putative addiction module antidote protein | Antitoxin |
N0O74_RS21385 (N0O74_21385) | 4572294..4572581 | - | 288 | WP_012478870.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
N0O74_RS21390 (N0O74_21390) | 4572815..4573414 | + | 600 | WP_012478869.1 | hypothetical protein | - |
N0O74_RS21395 (N0O74_21395) | 4573442..4574566 | + | 1125 | WP_012478868.1 | hypothetical protein | - |
N0O74_RS21400 (N0O74_21400) | 4574906..4575454 | - | 549 | WP_261728513.1 | DUF3313 domain-containing protein | - |
N0O74_RS21405 (N0O74_21405) | 4576015..4577121 | - | 1107 | WP_261728079.1 | AraC family transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 10802.42 Da Isoelectric Point: 10.8940
>T259388 WP_012478870.1 NZ_CP104863:c4572581-4572294 [Stenotrophomonas maltophilia]
MKIQRTRQFATWIDALKDVTARARILARIGRLAEGHPGDHRYLGDGISELRIDAGPGYRLYYTQRGRQLLILLVGGDKSS
QQRDIEKAREIARAL
MKIQRTRQFATWIDALKDVTARARILARIGRLAEGHPGDHRYLGDGISELRIDAGPGYRLYYTQRGRQLLILLVGGDKSS
QQRDIEKAREIARAL
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|