Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/HicA-HicB |
Location | 5074355..5074959 | Replicon | chromosome |
Accession | NZ_CP104861 | ||
Organism | Pseudomonas fragi strain D12 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | - |
Locus tag | N7D90_RS23265 | Protein ID | WP_261740171.1 |
Coordinates | 5074762..5074959 (-) | Length | 66 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | N7D90_RS23260 | Protein ID | WP_261740170.1 |
Coordinates | 5074355..5074765 (-) | Length | 137 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N7D90_RS23240 (N7D90_23240) | 5069624..5070604 | + | 981 | WP_261740166.1 | integrase domain-containing protein | - |
N7D90_RS23245 (N7D90_23245) | 5070601..5070888 | + | 288 | WP_261740167.1 | hypothetical protein | - |
N7D90_RS23250 (N7D90_23250) | 5070914..5072503 | - | 1590 | WP_261740168.1 | TIGR04141 family sporadically distributed protein | - |
N7D90_RS23255 (N7D90_23255) | 5072948..5073817 | - | 870 | WP_261740169.1 | AraC family transcriptional regulator | - |
N7D90_RS23260 (N7D90_23260) | 5074355..5074765 | - | 411 | WP_261740170.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
N7D90_RS23265 (N7D90_23265) | 5074762..5074959 | - | 198 | WP_261740171.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
N7D90_RS23270 (N7D90_23270) | 5075238..5075738 | + | 501 | WP_261740172.1 | sigma-70 family RNA polymerase sigma factor | - |
N7D90_RS23275 (N7D90_23275) | 5075738..5076685 | + | 948 | WP_261740173.1 | FecR domain-containing protein | - |
N7D90_RS23280 (N7D90_23280) | 5076798..5079236 | + | 2439 | WP_261740174.1 | TonB-dependent siderophore receptor | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 66 a.a. Molecular weight: 7145.34 Da Isoelectric Point: 10.9003
>T259386 WP_261740171.1 NZ_CP104861:c5074959-5074762 [Pseudomonas fragi]
VRSRELIELLIADGWFEIAVKGSHHQFKHPAKAGRVTVPHPKAEIAKGTLHNILKSAGLKGELRS
VRSRELIELLIADGWFEIAVKGSHHQFKHPAKAGRVTVPHPKAEIAKGTLHNILKSAGLKGELRS
Download Length: 198 bp
Antitoxin
Download Length: 137 a.a. Molecular weight: 14773.67 Da Isoelectric Point: 4.4621
>AT259386 WP_261740170.1 NZ_CP104861:c5074765-5074355 [Pseudomonas fragi]
MKFPVVLHKDADSEFSVTVPDVPGCFSAGSTFSQALDNVLEALALHLEGVVADGGELPQAKDVDAHLDNPDYVGGIWAVV
DFDLTPYLGKSVRFNASLPENLLLRIDERVSKDHRYASRSGFLATAALRELSIQVF
MKFPVVLHKDADSEFSVTVPDVPGCFSAGSTFSQALDNVLEALALHLEGVVADGGELPQAKDVDAHLDNPDYVGGIWAVV
DFDLTPYLGKSVRFNASLPENLLLRIDERVSKDHRYASRSGFLATAALRELSIQVF
Download Length: 411 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|