Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 4548926..4549442 | Replicon | chromosome |
Accession | NZ_CP104861 | ||
Organism | Pseudomonas fragi strain D12 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A8I1FXC2 |
Locus tag | N7D90_RS21105 | Protein ID | WP_019827368.1 |
Coordinates | 4549155..4549442 (+) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | N7D90_RS21100 | Protein ID | WP_261739795.1 |
Coordinates | 4548926..4549165 (+) | Length | 80 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N7D90_RS21080 (N7D90_21080) | 4544021..4544932 | - | 912 | WP_261739791.1 | TauD/TfdA family dioxygenase | - |
N7D90_RS21085 (N7D90_21085) | 4545117..4546334 | - | 1218 | WP_261739792.1 | benzoate/H(+) symporter BenE family transporter | - |
N7D90_RS21090 (N7D90_21090) | 4546425..4547918 | + | 1494 | WP_261739793.1 | PLP-dependent aminotransferase family protein | - |
N7D90_RS21095 (N7D90_21095) | 4548087..4548434 | - | 348 | WP_261739794.1 | DUF3077 domain-containing protein | - |
N7D90_RS21100 (N7D90_21100) | 4548926..4549165 | + | 240 | WP_261739795.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
N7D90_RS21105 (N7D90_21105) | 4549155..4549442 | + | 288 | WP_019827368.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
N7D90_RS21110 (N7D90_21110) | 4549563..4550774 | + | 1212 | WP_261739796.1 | CmpA/NrtA family ABC transporter substrate-binding protein | - |
N7D90_RS21115 (N7D90_21115) | 4550789..4551364 | + | 576 | WP_261739797.1 | ANTAR domain-containing protein | - |
N7D90_RS21120 (N7D90_21120) | 4551616..4552827 | + | 1212 | WP_261739798.1 | nitrate/nitrite transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11347.25 Da Isoelectric Point: 10.3151
>T259384 WP_019827368.1 NZ_CP104861:4549155-4549442 [Pseudomonas fragi]
MTFDLEFDQRALKEWHKLADTVRLQFKSKLSEVLLNPRVEANRLRKLPDCYKIKLRSAGYRLIYQVIDQEVVVFVVAVDK
REHQAAYRKAQDRLK
MTFDLEFDQRALKEWHKLADTVRLQFKSKLSEVLLNPRVEANRLRKLPDCYKIKLRSAGYRLIYQVIDQEVVVFVVAVDK
REHQAAYRKAQDRLK
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|