Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-DnaT
Location 43968..44490 Replicon plasmid pTL-2
Accession NZ_CP104859
Organism Salmonella sp. 3C

Toxin (Protein)


Gene name relE Uniprot ID G3CAN5
Locus tag N7E69_RS24010 Protein ID WP_000220560.1
Coordinates 44209..44490 (+) Length 94 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID G3CAG1
Locus tag N7E69_RS24005 Protein ID WP_000121743.1
Coordinates 43968..44219 (+) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N7E69_RS23980 (N7E69_23980) 39379..39999 + 621 WP_000864788.1 ParA family protein -
N7E69_RS23985 (N7E69_23985) 40051..40281 + 231 WP_108629079.1 plasmid partition protein ParG -
N7E69_RS23990 (N7E69_23990) 40920..41273 - 354 WP_001675596.1 DNA distortion polypeptide 3 -
N7E69_RS23995 (N7E69_23995) 41410..41856 - 447 WP_001074381.1 hypothetical protein -
N7E69_RS24000 (N7E69_24000) 41896..42732 - 837 WP_001575533.1 replication initiation protein -
N7E69_RS24005 (N7E69_24005) 43968..44219 + 252 WP_000121743.1 plasmid stabilization protein Antitoxin
N7E69_RS24010 (N7E69_24010) 44209..44490 + 282 WP_000220560.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
N7E69_RS24015 (N7E69_24015) 44636..44959 + 324 WP_001181909.1 hypothetical protein -
N7E69_RS24020 (N7E69_24020) 45004..45249 + 246 WP_000356542.1 hypothetical protein -
N7E69_RS24025 (N7E69_24025) 45239..45454 + 216 WP_001180117.1 hypothetical protein -
N7E69_RS24030 (N7E69_24030) 45547..45876 + 330 WP_000866650.1 hypothetical protein -
N7E69_RS24035 (N7E69_24035) 45919..46098 + 180 WP_001575529.1 hypothetical protein -
N7E69_RS24040 (N7E69_24040) 46168..46317 + 150 WP_000003880.1 hypothetical protein -
N7E69_RS24045 (N7E69_24045) 46330..46602 + 273 WP_000160399.1 hypothetical protein -
N7E69_RS24050 (N7E69_24050) 46928..47473 + 546 WP_000757691.1 DNA distortion polypeptide 1 -
N7E69_RS24055 (N7E69_24055) 47476..48657 + 1182 WP_000539536.1 MobP1 family relaxase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid blaTEM-1A faeH / faeI / spvC / spvB 1..79524 79524


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-86)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 94 a.a.        Molecular weight: 11005.83 Da        Isoelectric Point: 10.5938

>T259382 WP_000220560.1 NZ_CP104859:44209-44490 [Salmonella sp. 3C]
MTYELAFDRRALKEWQKLGHTIREQFKKKLAERLENPRVPAARLHGHADRYKIKLRASGYRLVYQVIDEKVVLLVIAVGR
RESSEVYQIADLR

Download         Length: 282 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9194.43 Da        Isoelectric Point: 4.1683

>AT259382 WP_000121743.1 NZ_CP104859:43968-44219 [Salmonella sp. 3C]
MSYQILTTTAASITDLKKNPMGTVAEGEGDAVAILNRNEPAFYCVPPKLYAYYRELAEDAELNAVADERMKNPEIVKVNL
DDL

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G3CAN5

Antitoxin

Source ID Structure
AlphaFold DB A0A3S5I301

References