Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 16321..16846 Replicon plasmid pTL-2
Accession NZ_CP104859
Organism Salmonella sp. 3C

Toxin (Protein)


Gene name ccdB Uniprot ID I3W3D5
Locus tag N7E69_RS23835 Protein ID WP_001159863.1
Coordinates 16541..16846 (+) Length 102 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID M7S5D0
Locus tag N7E69_RS23830 Protein ID WP_000813641.1
Coordinates 16321..16539 (+) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N7E69_RS23795 (N7E69_23795) 11348..12061 + 714 WP_000801115.1 hypothetical protein -
N7E69_RS23800 (N7E69_23800) 12186..12770 + 585 WP_001575501.1 hypothetical protein -
N7E69_RS23805 (N7E69_23805) 12879..13055 + 177 WP_139782396.1 FaeA/PapI family transcriptional regulator -
N7E69_RS23810 (N7E69_23810) 13316..13477 + 162 WP_001816720.1 hypothetical protein -
N7E69_RS23815 (N7E69_23815) 13503..14351 + 849 WP_000175391.1 SdiA-regulated domain-containing protein -
N7E69_RS23820 (N7E69_23820) 14921..15349 - 429 WP_000812999.1 type II toxin-antitoxin system VapC family toxin -
N7E69_RS23825 (N7E69_23825) 15346..15576 - 231 WP_001261283.1 type II toxin-antitoxin system VapB family antitoxin -
N7E69_RS23830 (N7E69_23830) 16321..16539 + 219 WP_000813641.1 type II toxin-antitoxin system antitoxin CcdA Antitoxin
N7E69_RS23835 (N7E69_23835) 16541..16846 + 306 WP_001159863.1 type II toxin-antitoxin system toxin CcdB Toxin
N7E69_RS23840 (N7E69_23840) 16848..17138 + 291 WP_001266176.1 hypothetical protein -
N7E69_RS23845 (N7E69_23845) 17135..17656 + 522 WP_000198608.1 hypothetical protein -
N7E69_RS23850 (N7E69_23850) 17691..18473 + 783 WP_000082169.1 site-specific integrase -
N7E69_RS23855 (N7E69_23855) 18482..19165 + 684 WP_001751692.1 EAL domain-containing protein -
N7E69_RS23860 (N7E69_23860) 19219..19707 + 489 WP_001075507.1 CaiF/GrlA family transcriptional regulator -
N7E69_RS23865 (N7E69_23865) 19701..20037 + 337 Protein_30 hypothetical protein -
N7E69_RS23870 (N7E69_23870) 19947..20369 + 423 WP_225236769.1 LysM peptidoglycan-binding domain-containing protein -
N7E69_RS23875 (N7E69_23875) 20264..20809 + 546 WP_071591236.1 inverse autotransporter beta domain-containing protein -
N7E69_RS23880 (N7E69_23880) 20876..21244 - 369 WP_001675946.1 helix-turn-helix domain-containing protein -
N7E69_RS23885 (N7E69_23885) 21301..21726 + 426 WP_000064919.1 IS200/IS605 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid blaTEM-1A faeH / faeI / spvC / spvB 1..79524 79524


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-100)

Antitoxin

Post-segregation antitoxin CcdA

(2-72)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11587.48 Da        Isoelectric Point: 6.9787

>T259381 WP_001159863.1 NZ_CP104859:16541-16846 [Salmonella sp. 3C]
MQFKVYTCKRESRYRLFVDVQSDIIDTPGRRMAVPLVSARLLSEKVPRDLYPVMHIGDEPYRLLTTDMTSVPATVIGEEV
ADLSLRENDIKNAINLMFRGI

Download         Length: 306 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8314.16 Da        Isoelectric Point: 4.5203

>AT259381 WP_000813641.1 NZ_CP104859:16321-16539 [Salmonella sp. 3C]
MKQRITVTVDSDSYQLLKAYDVNISGLVSTTMQNEARRLRAERWQEENREGMAEVASFIEANGSFADDNRNW

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB I3W3D5

Antitoxin

Source ID Structure
AlphaFold DB A0A656ICA6

References