Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3040606..3041226 | Replicon | chromosome |
Accession | NZ_CP104858 | ||
Organism | Salmonella sp. 3C |
Toxin (Protein)
Gene name | Hha | Uniprot ID | V1H8E6 |
Locus tag | N7E69_RS14345 | Protein ID | WP_001280991.1 |
Coordinates | 3040606..3040824 (-) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | V1H4V6 |
Locus tag | N7E69_RS14350 | Protein ID | WP_000344807.1 |
Coordinates | 3040852..3041226 (-) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N7E69_RS14305 (3035829) | 3035829..3036398 | + | 570 | WP_000779802.1 | YbaY family lipoprotein | - |
N7E69_RS14310 (3036431) | 3036431..3036820 | - | 390 | WP_000961287.1 | MGMT family protein | - |
N7E69_RS14320 (3037051) | 3037051..3038601 | - | 1551 | WP_000213140.1 | EAL domain-containing protein | - |
N7E69_RS14325 (3038826) | 3038826..3039086 | + | 261 | WP_000801415.1 | type B 50S ribosomal protein L31 | - |
N7E69_RS14330 (3039092) | 3039092..3039232 | + | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
N7E69_RS14335 (3039288) | 3039288..3039758 | - | 471 | WP_000136183.1 | YlaC family protein | - |
N7E69_RS14340 (3039876) | 3039876..3040427 | - | 552 | WP_001278787.1 | maltose O-acetyltransferase | - |
N7E69_RS14345 (3040606) | 3040606..3040824 | - | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
N7E69_RS14350 (3040852) | 3040852..3041226 | - | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
N7E69_RS14355 (3041722) | 3041722..3044871 | - | 3150 | WP_001132508.1 | efflux RND transporter permease AcrB | - |
N7E69_RS14360 (3044894) | 3044894..3046087 | - | 1194 | WP_001039202.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T259375 WP_001280991.1 NZ_CP104858:c3040824-3040606 [Salmonella sp. 3C]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT259375 WP_000344807.1 NZ_CP104858:c3041226-3040852 [Salmonella sp. 3C]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|