Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 2391213..2391763 Replicon chromosome
Accession NZ_CP104858
Organism Salmonella sp. 3C

Toxin (Protein)


Gene name ccdB Uniprot ID M7RJ32
Locus tag N7E69_RS11350 Protein ID WP_001199743.1
Coordinates 2391455..2391763 (+) Length 103 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID M7RP97
Locus tag N7E69_RS11345 Protein ID WP_001118105.1
Coordinates 2391213..2391452 (+) Length 80 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N7E69_RS11310 (2386652) 2386652..2387683 - 1032 WP_000453348.1 L-idonate 5-dehydrogenase -
N7E69_RS11315 (2387900) 2387900..2388430 + 531 WP_000896758.1 gluconokinase -
N7E69_RS11320 (2388458) 2388458..2389477 - 1020 WP_000152558.1 NAD(P)-dependent alcohol dehydrogenase -
N7E69_RS11330 (2390234) 2390234..2390665 + 432 Protein_2195 helix-turn-helix domain-containing protein -
N7E69_RS11335 (2390696) 2390696..2390779 + 84 WP_228958541.1 DUF4942 domain-containing protein -
N7E69_RS11340 (2390856) 2390856..2391104 + 249 WP_000168389.1 ribbon-helix-helix domain-containing protein -
N7E69_RS11345 (2391213) 2391213..2391452 + 240 WP_001118105.1 type II toxin-antitoxin system CcdA family antitoxin Antitoxin
N7E69_RS11350 (2391455) 2391455..2391763 + 309 WP_001199743.1 CcdB family protein Toxin
N7E69_RS11355 (2392169) 2392169..2392309 + 141 Protein_2200 Arm DNA-binding domain-containing protein -
N7E69_RS11360 (2392341) 2392341..2393474 - 1134 Protein_2201 IS3 family transposase -
N7E69_RS11365 (2393797) 2393797..2394327 + 531 WP_000909460.1 SEF14 fimbria major subunit SefA -
N7E69_RS11370 (2394449) 2394449..2395189 + 741 WP_001575372.1 SEF14/SEF18 fimbria chaperone SefB -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside IScluster/Tn - - 2390279..2393382 3103


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-101)

Antitoxin

Post-segregation antitoxin CcdA

(9-79)


Sequences

Toxin        


Download         Length: 103 a.a.        Molecular weight: 11845.67 Da        Isoelectric Point: 6.7228

>T259371 WP_001199743.1 NZ_CP104858:2391455-2391763 [Salmonella sp. 3C]
MQYMVYRNKGNSKAYPYLLDVQSDIIDELHTRMVIPLFPVSRLVNNPVKRLTPTLNVEGNDYLVMTHEMASIRLSQIGDE
VMDVRSHRQTIKNALDFIFDGF

Download         Length: 309 bp

Antitoxin


Download         Length: 80 a.a.        Molecular weight: 8719.90 Da        Isoelectric Point: 6.4633

>AT259371 WP_001118105.1 NZ_CP104858:2391213-2391452 [Salmonella sp. 3C]
MPGMSVRHKKTVSVTLEPALLQQARDAGINLSAVLTAALKEEISATGVERWKAENRAGLQELNRITDEHGLLSDDYRTF

Download         Length: 240 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A6C6Z9V9

Antitoxin

Source ID Structure
AlphaFold DB A0A5H9SZK8

References