Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 2242890..2243671 | Replicon | chromosome |
Accession | NZ_CP104858 | ||
Organism | Salmonella sp. 3C |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | A0A0R9NZI3 |
Locus tag | N7E69_RS10560 | Protein ID | WP_000625912.1 |
Coordinates | 2243180..2243671 (+) | Length | 164 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | M7RNV8 |
Locus tag | N7E69_RS10555 | Protein ID | WP_001110450.1 |
Coordinates | 2242890..2243183 (+) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N7E69_RS10525 (2239214) | 2239214..2240119 | + | 906 | WP_001268195.1 | YjiK family protein | - |
N7E69_RS10530 (2240413) | 2240413..2240682 | - | 270 | WP_077906657.1 | hypothetical protein | - |
N7E69_RS10535 (2240690) | 2240690..2240905 | - | 216 | WP_001595136.1 | hypothetical protein | - |
N7E69_RS10540 (2240928) | 2240928..2241215 | - | 288 | WP_001269916.1 | transcriptional regulator RtsB | - |
N7E69_RS10545 (2241212) | 2241212..2242087 | - | 876 | WP_108610913.1 | AraC family transcriptional regulator | - |
N7E69_RS10550 (2242351) | 2242351..2242573 | - | 223 | Protein_2044 | hypothetical protein | - |
N7E69_RS10555 (2242890) | 2242890..2243183 | + | 294 | WP_001110450.1 | DUF1778 domain-containing protein | Antitoxin |
N7E69_RS10560 (2243180) | 2243180..2243671 | + | 492 | WP_000625912.1 | GNAT family N-acetyltransferase | Toxin |
N7E69_RS10565 (2243919) | 2243919..2244671 | - | 753 | WP_000842432.1 | non-specific acid phosphatase | - |
N7E69_RS10570 (2244771) | 2244771..2244848 | - | 78 | Protein_2048 | porin family protein | - |
N7E69_RS10575 (2245228) | 2245228..2245302 | + | 75 | Protein_2049 | helix-turn-helix domain-containing protein | - |
N7E69_RS10585 (2245573) | 2245573..2246148 | - | 576 | WP_001188509.1 | transcriptional regulator | - |
N7E69_RS10590 (2246185) | 2246185..2247888 | - | 1704 | WP_000068885.1 | protein-disulfide reductase DsbD | - |
N7E69_RS10595 (2247864) | 2247864..2248211 | - | 348 | WP_000887832.1 | divalent cation tolerance protein CutA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 164 a.a. Molecular weight: 17606.43 Da Isoelectric Point: 7.7297
>T259369 WP_000625912.1 NZ_CP104858:2243180-2243671 [Salmonella sp. 3C]
MISSPEPLHAGHILTPFCCGVDSMDNWLKQRAMKNQTTGASRTFVCCGSDSSVLAYYSLASSAVTTNTAPGRFRRNMPDP
IPIVVLGRLAVDKSLHGQGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQRVGFVPSPMDPMMLMVTLGDLV
ESV
MISSPEPLHAGHILTPFCCGVDSMDNWLKQRAMKNQTTGASRTFVCCGSDSSVLAYYSLASSAVTTNTAPGRFRRNMPDP
IPIVVLGRLAVDKSLHGQGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQRVGFVPSPMDPMMLMVTLGDLV
ESV
Download Length: 492 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0R9NZI3 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0R9PGG6 |