Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 1542823..1543583 | Replicon | chromosome |
| Accession | NZ_CP104858 | ||
| Organism | Salmonella sp. 3C | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | Q57IH1 |
| Locus tag | N7E69_RS07350 | Protein ID | WP_000533909.1 |
| Coordinates | 1542823..1543308 (-) | Length | 162 a.a. |
Antitoxin (Protein)
| Gene name | tacA | Uniprot ID | M7RHS4 |
| Locus tag | N7E69_RS07355 | Protein ID | WP_000965886.1 |
| Coordinates | 1543296..1543583 (-) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N7E69_RS07320 (1537891) | 1537891..1538553 | + | 663 | WP_000747548.1 | OmpA family lipoprotein | - |
| N7E69_RS07325 (1538772) | 1538772..1539750 | + | 979 | Protein_1428 | glyoxylate/hydroxypyruvate reductase GhrB | - |
| N7E69_RS07330 (1539800) | 1539800..1540510 | - | 711 | WP_000190524.1 | DUF3053 domain-containing protein | - |
| N7E69_RS07335 (1540949) | 1540949..1541239 | + | 291 | WP_000455790.1 | HTH-type transcriptional regulator | - |
| N7E69_RS07340 (1541527) | 1541527..1541739 | + | 213 | WP_000014594.1 | RNA chaperone/antiterminator CspA | - |
| N7E69_RS07345 (1541913) | 1541913..1542452 | + | 540 | WP_000047147.1 | copper-binding periplasmic metallochaperone CueP | - |
| N7E69_RS07350 (1542823) | 1542823..1543308 | - | 486 | WP_000533909.1 | GNAT family N-acetyltransferase | Toxin |
| N7E69_RS07355 (1543296) | 1543296..1543583 | - | 288 | WP_000965886.1 | DUF1778 domain-containing protein | Antitoxin |
| N7E69_RS07360 (1543761) | 1543761..1544228 | - | 468 | WP_000702452.1 | GNAT family N-acetyltransferase | - |
| N7E69_RS07365 (1544445) | 1544445..1544798 | - | 354 | Protein_1436 | IS3 family transposase | - |
| N7E69_RS07370 (1545188) | 1545188..1547257 | - | 2070 | WP_001291741.1 | glycine--tRNA ligase subunit beta | - |
| N7E69_RS07375 (1547267) | 1547267..1548178 | - | 912 | WP_001168551.1 | glycine--tRNA ligase subunit alpha | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17703.41 Da Isoelectric Point: 9.8719
>T259366 WP_000533909.1 NZ_CP104858:c1543308-1542823 [Salmonella sp. 3C]
VGRVTAPEPLSAFHQVAEFVSGEAVLDDWLKQKGLKNQALGAARTFVVCKKDTKQVAGFYSLATGSVNHTEATGNLRRNM
PDPIPVIILARLAVDLSFHGKGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKNFYIHHGFKSSQTQQRTLFLRLP
Q
VGRVTAPEPLSAFHQVAEFVSGEAVLDDWLKQKGLKNQALGAARTFVVCKKDTKQVAGFYSLATGSVNHTEATGNLRRNM
PDPIPVIILARLAVDLSFHGKGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKNFYIHHGFKSSQTQQRTLFLRLP
Q
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 7F36 | |
| PDB | 7AK8 | |
| PDB | 5FVJ |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 7AK8 | |
| AlphaFold DB | A0A3V2JDX2 |