Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 1432879..1433465 Replicon chromosome
Accession NZ_CP104858
Organism Salmonella sp. 3C

Toxin (Protein)


Gene name doc Uniprot ID M7S4C0
Locus tag N7E69_RS06865 Protein ID WP_001575091.1
Coordinates 1432879..1433247 (-) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID M7SDJ3
Locus tag N7E69_RS06870 Protein ID WP_001520924.1
Coordinates 1433244..1433465 (-) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N7E69_RS06845 (1428398) 1428398..1429468 - 1071 WP_000907846.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -
N7E69_RS06850 (1429470) 1429470..1430315 - 846 WP_000572196.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
N7E69_RS06855 (1430312) 1430312..1431199 - 888 WP_000099303.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
N7E69_RS06860 (1431304) 1431304..1432620 - 1317 WP_000624752.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
N7E69_RS06865 (1432879) 1432879..1433247 - 369 WP_001575091.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
N7E69_RS06870 (1433244) 1433244..1433465 - 222 WP_001520924.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
N7E69_RS06875 (1433596) 1433596..1434309 - 714 WP_000416114.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
N7E69_RS06880 (1434311) 1434311..1435078 - 768 WP_001751764.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
N7E69_RS06885 (1435075) 1435075..1436352 - 1278 WP_000803764.1 branched chain amino acid ABC transporter permease LivM -
N7E69_RS06890 (1436349) 1436349..1437275 - 927 WP_000003007.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
N7E69_RS06895 (1437335) 1437335..1438444 - 1110 WP_000822976.1 high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1427661..1439249 11588


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(24-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-49)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13701.98 Da        Isoelectric Point: 5.6993

>T259365 WP_001575091.1 NZ_CP104858:c1433247-1432879 [Salmonella sp. 3C]
MTLQLISAEEIIQFHDRLLRVTPGVTGMPDPERAEALMYRVLNQIEYEGVTDVWLLAAMHLLTISRGYIFNDGNKRTALF
ITLLFLKRNGISLAANPDFVDMTVDAAAGRLTLEQIAVRLRA

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8152.14 Da        Isoelectric Point: 5.0775

>AT259365 WP_001520924.1 NZ_CP104858:c1433465-1433244 [Salmonella sp. 3C]
MRTVNYSEARQNLAEVLESAVTGGPVTITRRGHKSAVIISAEEFERYQTARMDDEFAAIMAVHGNELRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB M7S4C0

Antitoxin

Source ID Structure
AlphaFold DB A0A6C6Z871

References