Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 918409..919069 | Replicon | chromosome |
| Accession | NZ_CP104858 | ||
| Organism | Salmonella sp. 3C | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | Q57K70 |
| Locus tag | N7E69_RS04315 | Protein ID | WP_000244756.1 |
| Coordinates | 918409..918822 (-) | Length | 138 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | S5MU13 |
| Locus tag | N7E69_RS04320 | Protein ID | WP_000351186.1 |
| Coordinates | 918803..919069 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N7E69_RS04295 (914350) | 914350..916083 | - | 1734 | WP_000813387.1 | single-stranded-DNA-specific exonuclease RecJ | - |
| N7E69_RS04300 (916089) | 916089..916802 | - | 714 | WP_000745614.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| N7E69_RS04305 (916826) | 916826..917722 | - | 897 | WP_000434302.1 | site-specific tyrosine recombinase XerD | - |
| N7E69_RS04310 (917835) | 917835..918356 | + | 522 | WP_001055885.1 | flavodoxin FldB | - |
| N7E69_RS04315 (918409) | 918409..918822 | - | 414 | WP_000244756.1 | protein YgfX | Toxin |
| N7E69_RS04320 (918803) | 918803..919069 | - | 267 | WP_000351186.1 | FAD assembly factor SdhE | Antitoxin |
| N7E69_RS04325 (919319) | 919319..920299 | + | 981 | WP_000874174.1 | tRNA-modifying protein YgfZ | - |
| N7E69_RS04330 (920415) | 920415..921074 | - | 660 | WP_000250289.1 | hemolysin III family protein | - |
| N7E69_RS04335 (921236) | 921236..921550 | - | 315 | WP_001182980.1 | N(4)-acetylcytidine aminohydrolase | - |
| N7E69_RS04340 (921705) | 921705..923138 | + | 1434 | WP_001230141.1 | 6-phospho-beta-glucosidase BglA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 138 a.a. Molecular weight: 16183.15 Da Isoelectric Point: 10.7537
>T259363 WP_000244756.1 NZ_CP104858:c918822-918409 [Salmonella sp. 3C]
VVLWQSDLRVSWRAQWISLLIHGLVAAVILLMPWPLSYTPLWMILLSLVVFDCVRSQRRINTCQGEIKLLMDGRLRWQGQ
DWTLLRPPWLLKSGMVLRLRAESGRHQHLWLAADSMEEAEWRELRRILLQQPISGQH
VVLWQSDLRVSWRAQWISLLIHGLVAAVILLMPWPLSYTPLWMILLSLVVFDCVRSQRRINTCQGEIKLLMDGRLRWQGQ
DWTLLRPPWLLKSGMVLRLRAESGRHQHLWLAADSMEEAEWRELRRILLQQPISGQH
Download Length: 414 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3Z1E9V5 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5I0YWH4 |