Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 907520..908145 | Replicon | chromosome |
| Accession | NZ_CP104858 | ||
| Organism | Salmonella sp. 3C | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | M7SD17 |
| Locus tag | N7E69_RS04250 | Protein ID | WP_000911336.1 |
| Coordinates | 907520..907918 (-) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | M7S3S8 |
| Locus tag | N7E69_RS04255 | Protein ID | WP_000557549.1 |
| Coordinates | 907918..908145 (-) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N7E69_RS04235 (904197) | 904197..904778 | - | 582 | WP_001244651.1 | fimbrial protein | - |
| N7E69_RS04240 (905497) | 905497..906129 | - | 633 | WP_000835265.1 | YfdX family protein | - |
| N7E69_RS04245 (906176) | 906176..906712 | - | 537 | WP_001038502.1 | STM3031 family outer membrane protein | - |
| N7E69_RS04250 (907520) | 907520..907918 | - | 399 | WP_000911336.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
| N7E69_RS04255 (907918) | 907918..908145 | - | 228 | WP_000557549.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
| N7E69_RS04260 (908354) | 908354..908605 | + | 252 | WP_001576352.1 | hypothetical protein | - |
| N7E69_RS04265 (908885) | 908885..909691 | + | 807 | WP_001574939.1 | DUF1460 domain-containing protein | - |
| N7E69_RS04275 (909976) | 909976..910734 | - | 759 | WP_000244328.1 | amidase activator ActS | - |
| N7E69_RS04280 (910999) | 910999..911544 | + | 546 | WP_000133994.1 | isopentenyl-diphosphate Delta-isomerase | - |
| N7E69_RS04285 (911620) | 911620..913137 | - | 1518 | WP_000003339.1 | lysine--tRNA ligase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 899075..909691 | 10616 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14938.30 Da Isoelectric Point: 7.2155
>T259362 WP_000911336.1 NZ_CP104858:c907918-907520 [Salmonella sp. 3C]
MLKFMLDTNTCIFTIKNKPEHIRERFNLNTSRMCISSITLMELIYGAEKSLAPERNLAVVEGFISRLEVLDYDTQAAIHT
GQIRAELARKGTPVGPYDQMIAGHAGSRGLVVVTNNLREFERIPGIRIEDWC
MLKFMLDTNTCIFTIKNKPEHIRERFNLNTSRMCISSITLMELIYGAEKSLAPERNLAVVEGFISRLEVLDYDTQAAIHT
GQIRAELARKGTPVGPYDQMIAGHAGSRGLVVVTNNLREFERIPGIRIEDWC
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 6IFC | |
| PDB | 6IFM |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 6IFM | |
| AlphaFold DB | A0A3V2Y5V5 |