Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | omega-epsilon-zeta/zeta-epsilon |
| Location | 32887..34024 | Replicon | plasmid pNY13412 |
| Accession | NZ_CP104857 | ||
| Organism | Enterococcus faecalis strain NY13412 | ||
Toxin (Protein)
| Gene name | zeta | Uniprot ID | P0A4M2 |
| Locus tag | N7M47_RS14965 | Protein ID | WP_002332783.1 |
| Coordinates | 32887..33750 (-) | Length | 288 a.a. |
Antitoxin (Protein)
| Gene name | epsilon | Uniprot ID | Q9AL19 |
| Locus tag | N7M47_RS14970 | Protein ID | WP_002326825.1 |
| Coordinates | 33752..34024 (-) | Length | 91 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N7M47_RS14945 (N7M47_14950) | 29021..29305 | + | 285 | WP_000922261.1 | hypothetical protein | - |
| N7M47_RS14950 (N7M47_14955) | 29312..31264 | + | 1953 | WP_128701263.1 | insertion element protein | - |
| N7M47_RS14955 (N7M47_14960) | 31336..31833 | - | 498 | WP_000868795.1 | trimethoprim-resistant dihydrofolate reductase DfrG | - |
| N7M47_RS14960 (N7M47_14965) | 32130..32447 | - | 318 | WP_002326830.1 | hypothetical protein | - |
| N7M47_RS14965 (N7M47_14970) | 32887..33750 | - | 864 | WP_002332783.1 | zeta toxin family protein | Toxin |
| N7M47_RS14970 (N7M47_14975) | 33752..34024 | - | 273 | WP_002326825.1 | antitoxin | Antitoxin |
| N7M47_RS14975 (N7M47_14980) | 34042..34257 | - | 216 | WP_001835296.1 | peptide-binding protein | - |
| N7M47_RS14980 (N7M47_14985) | 34349..35245 | - | 897 | WP_002326827.1 | ParA family protein | - |
| N7M47_RS14985 (N7M47_14990) | 35348..35608 | - | 261 | Protein_42 | topoisomerase DNA-binding C4 zinc finger domain-containing protein | - |
| N7M47_RS14990 (N7M47_14995) | 35778..36515 | - | 738 | WP_002292226.1 | 23S rRNA (adenine(2058)-N(6))-methyltransferase Erm(B) | - |
| N7M47_RS14995 (N7M47_15000) | 36640..36723 | - | 84 | WP_001814874.1 | 23S rRNA methyltransferase attenuation leader peptide | - |
| N7M47_RS15000 | 36772..36857 | - | 86 | Protein_45 | peptide-binding protein | - |
| N7M47_RS15005 (N7M47_15005) | 37267..38061 | - | 795 | WP_001096887.1 | aminoglycoside O-phosphotransferase APH(3')-IIIa | - |
| N7M47_RS15010 (N7M47_15010) | 38154..38696 | - | 543 | WP_000627290.1 | streptothricin N-acetyltransferase Sat4 | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | dfrG / erm(B) / aph(3')-III / ant(6)-Ia / aac(6')-aph(2'') | - | 1..49839 | 49839 | |
| - | inside | IScluster/Tn | dfrG / erm(B) / aph(3')-III / ant(6)-Ia / aac(6')-aph(2'') | - | 21734..44160 | 22426 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 288 a.a. Molecular weight: 32675.27 Da Isoelectric Point: 7.3939
>T259360 WP_002332783.1 NZ_CP104857:c33750-32887 [Enterococcus faecalis]
MANITDFTEKQFEDRLEKNVERLTKNRLAVESPTAFLLGGQPGSGKTSLRSAISEETQGNVVIIDNDTFKQQHPNFDELV
KLYEKDVVKYVTPYSNRMTEAIISRLRDKGYNLVIEGTGRTTDVPIQTATMLQAKDYETKMYVMAVPKINSYLGTIERYE
TMYADDPMTARATPKQAHDIVVKNLPTNLETLHKTGLFSDIRLYNREGVKLYSSLETPSISPKETLERELNRKVSGKEIQ
PTLERIEQKMVQNQHQETPEFKAIQQKMESLQPPTPPIPKTPKLPGI
MANITDFTEKQFEDRLEKNVERLTKNRLAVESPTAFLLGGQPGSGKTSLRSAISEETQGNVVIIDNDTFKQQHPNFDELV
KLYEKDVVKYVTPYSNRMTEAIISRLRDKGYNLVIEGTGRTTDVPIQTATMLQAKDYETKMYVMAVPKINSYLGTIERYE
TMYADDPMTARATPKQAHDIVVKNLPTNLETLHKTGLFSDIRLYNREGVKLYSSLETPSISPKETLERELNRKVSGKEIQ
PTLERIEQKMVQNQHQETPEFKAIQQKMESLQPPTPPIPKTPKLPGI
Download Length: 864 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | P0A4M2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0M2AF93 |