Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907(toxin) |
Location | 10244..10815 | Replicon | plasmid pNY13412 |
Accession | NZ_CP104857 | ||
Organism | Enterococcus faecalis strain NY13412 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | N7M47_RS14845 | Protein ID | WP_128701244.1 |
Coordinates | 10474..10815 (+) | Length | 114 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | R3KHK9 |
Locus tag | N7M47_RS14840 | Protein ID | WP_002362431.1 |
Coordinates | 10244..10474 (+) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N7M47_RS14805 (N7M47_14810) | 5355..5606 | - | 252 | WP_064686964.1 | hypothetical protein | - |
N7M47_RS14810 (N7M47_14815) | 5699..5827 | + | 129 | WP_258076850.1 | hypothetical protein | - |
N7M47_RS14815 (N7M47_14820) | 6217..8013 | - | 1797 | WP_064686966.1 | AIPR family protein | - |
N7M47_RS14820 (N7M47_14825) | 8217..8417 | - | 201 | WP_064686967.1 | hypothetical protein | - |
N7M47_RS14825 (N7M47_14830) | 8901..9122 | - | 222 | WP_080474121.1 | hypothetical protein | - |
N7M47_RS14830 (N7M47_14835) | 9119..9403 | - | 285 | WP_064686968.1 | hypothetical protein | - |
N7M47_RS14835 (N7M47_14840) | 9420..10040 | - | 621 | WP_161970397.1 | recombinase family protein | - |
N7M47_RS14840 (N7M47_14845) | 10244..10474 | + | 231 | WP_002362431.1 | hypothetical protein | Antitoxin |
N7M47_RS14845 (N7M47_14850) | 10474..10815 | + | 342 | WP_128701244.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
N7M47_RS14850 (N7M47_14855) | 10929..11867 | + | 939 | WP_128701245.1 | hypothetical protein | - |
N7M47_RS14855 (N7M47_14860) | 12133..12735 | + | 603 | WP_128701246.1 | Fic family protein | - |
N7M47_RS14860 (N7M47_14865) | 12820..13680 | + | 861 | WP_128701247.1 | abortive infection system antitoxin AbiGi family protein | - |
N7M47_RS14865 (N7M47_14870) | 13682..14893 | + | 1212 | WP_128701248.1 | abortive infection system toxin AbiGii family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | dfrG / erm(B) / aph(3')-III / ant(6)-Ia / aac(6')-aph(2'') | - | 1..49839 | 49839 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 13201.42 Da Isoelectric Point: 9.3988
>T259359 WP_128701244.1 NZ_CP104857:10474-10815 [Enterococcus faecalis]
MSDEKKYIPKKGDIVWIDFDPSAGKEIQKRRPGLVVSRYEFNRKTMFAVICPITSTIKNIPTRYTLPDEMETHGQVVISQ
LKSLDFTERKLSQIEHLPLKDMAKINQIIEYIF
MSDEKKYIPKKGDIVWIDFDPSAGKEIQKRRPGLVVSRYEFNRKTMFAVICPITSTIKNIPTRYTLPDEMETHGQVVISQ
LKSLDFTERKLSQIEHLPLKDMAKINQIIEYIF
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|