Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ImmA-IrrE/HTH_19(antitoxin) |
Location | 1923072..1923765 | Replicon | chromosome |
Accession | NZ_CP104856 | ||
Organism | Enterococcus faecalis strain NY13412 |
Toxin (Protein)
Gene name | IrrE | Uniprot ID | S4BLV4 |
Locus tag | N7M47_RS09645 | Protein ID | WP_002378467.1 |
Coordinates | 1923421..1923765 (+) | Length | 115 a.a. |
Antitoxin (Protein)
Gene name | ImmA | Uniprot ID | - |
Locus tag | N7M47_RS09640 | Protein ID | WP_002364355.1 |
Coordinates | 1923072..1923404 (+) | Length | 111 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N7M47_RS09595 (1918544) | 1918544..1919278 | - | 735 | WP_002378463.1 | ERF family protein | - |
N7M47_RS09600 (1919271) | 1919271..1919588 | - | 318 | WP_002357007.1 | hypothetical protein | - |
N7M47_RS09605 (1919808) | 1919808..1920362 | + | 555 | WP_002357006.1 | hypothetical protein | - |
N7M47_RS09610 (1920789) | 1920789..1920983 | - | 195 | WP_002378464.1 | hypothetical protein | - |
N7M47_RS09615 (1921020) | 1921020..1921229 | - | 210 | WP_002378465.1 | hypothetical protein | - |
N7M47_RS09620 (1921284) | 1921284..1921472 | + | 189 | WP_002357001.1 | YegP family protein | - |
N7M47_RS09625 (1921498) | 1921498..1922223 | - | 726 | WP_002378466.1 | phage regulatory protein | - |
N7M47_RS09630 (1922262) | 1922262..1922573 | - | 312 | WP_002381719.1 | hypothetical protein | - |
N7M47_RS09635 (1922584) | 1922584..1922760 | - | 177 | WP_002364354.1 | helix-turn-helix transcriptional regulator | - |
N7M47_RS09640 (1923072) | 1923072..1923404 | + | 333 | WP_002364355.1 | helix-turn-helix transcriptional regulator | Antitoxin |
N7M47_RS09645 (1923421) | 1923421..1923765 | + | 345 | WP_002378467.1 | ImmA/IrrE family metallo-endopeptidase | Toxin |
N7M47_RS09650 (1923801) | 1923801..1924529 | + | 729 | WP_002378468.1 | potassium channel family protein | - |
N7M47_RS09655 (1924629) | 1924629..1925777 | + | 1149 | WP_002378469.1 | site-specific integrase | - |
N7M47_RS09660 (1925814) | 1925814..1926248 | - | 435 | Protein_1870 | competence type IV pilus minor pilin ComGD | - |
N7M47_RS09665 (1926245) | 1926245..1926520 | - | 276 | WP_002356991.1 | competence type IV pilus major pilin ComGC | - |
N7M47_RS09670 (1926520) | 1926520..1927566 | - | 1047 | WP_002369171.1 | competence type IV pilus assembly protein ComGB | - |
N7M47_RS09675 (1927523) | 1927523..1928491 | - | 969 | WP_002364362.1 | competence type IV pilus ATPase ComGA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 1886734..1926221 | 39487 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 115 a.a. Molecular weight: 13712.62 Da Isoelectric Point: 5.5523
>T259350 WP_002378467.1 NZ_CP104856:1923421-1923765 [Enterococcus faecalis]
MKSIKELVEEYEVELVFAPINKRACYEPVKRIIFVNQNLSIEEQEESIFHEFKHVVSHSDYIELYKIPSFRNKMEAEADY
HMFKCLIEKHDGQFNYSNVITHYNLKMGQETYLN
MKSIKELVEEYEVELVFAPINKRACYEPVKRIIFVNQNLSIEEQEESIFHEFKHVVSHSDYIELYKIPSFRNKMEAEADY
HMFKCLIEKHDGQFNYSNVITHYNLKMGQETYLN
Download Length: 345 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|