259347

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relE-dinJ/YafQ-DinJ
Location 390879..391413 Replicon chromosome
Accession NZ_CP104856
Organism Enterococcus faecalis strain NY13412

Toxin (Protein)


Gene name relE Uniprot ID R3JX52
Locus tag N7M47_RS02000 Protein ID WP_002360769.1
Coordinates 391138..391413 (+) Length 92 a.a.

Antitoxin (Protein)


Gene name dinJ Uniprot ID R3H6P0
Locus tag N7M47_RS01995 Protein ID WP_002369771.1
Coordinates 390879..391145 (+) Length 89 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N7M47_RS01960 (386929) 386929..387522 + 594 WP_002414802.1 replication-relaxation family protein -
N7M47_RS01965 (387528) 387528..388016 + 489 WP_010710133.1 hypothetical protein -
N7M47_RS01970 (388608) 388608..388874 + 267 WP_002377947.1 hypothetical protein -
N7M47_RS01975 (388907) 388907..389407 + 501 WP_002360775.1 DnaJ domain-containing protein -
N7M47_RS01980 (389420) 389420..389668 + 249 WP_002360773.1 DUF3850 domain-containing protein -
N7M47_RS01985 (389744) 389744..390160 + 417 WP_010710134.1 single-stranded DNA-binding protein -
N7M47_RS01990 (390184) 390184..390768 + 585 WP_002377949.1 thermonuclease family protein -
N7M47_RS01995 (390879) 390879..391145 + 267 WP_002369771.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
N7M47_RS02000 (391138) 391138..391413 + 276 WP_002360769.1 type II toxin-antitoxin system YafQ family toxin Toxin
N7M47_RS02005 (391604) 391604..392248 - 645 WP_002377952.1 IS6 family transposase -
N7M47_RS02010 (392381) 392381..393263 + 883 Protein_372 IS256 family transposase -
N7M47_RS02015 (393568) 393568..394605 - 1038 WP_002355369.1 PTS sugar transporter subunit IIC -
N7M47_RS02020 (394631) 394631..395569 - 939 WP_002370935.1 2-dehydropantoate 2-reductase -
N7M47_RS02025 (395697) 395697..396026 - 330 WP_002358661.1 LPXTG cell wall anchor domain-containing protein -
N7M47_RS02030 (396056) 396056..396241 + 186 WP_002358660.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - bsh / cylR2 / cylR1 / cylL / cylS / cylM / cylB / cylA / cylI / esp 369789..428683 58894


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, YafQ-like toxin

(3-91)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(7-86)


Sequences

Toxin        


Download         Length: 92 a.a.        Molecular weight: 10732.58 Da        Isoelectric Point: 9.6918

>T259347 WP_002360769.1 NZ_CP104856:391138-391413 [Enterococcus faecalis]
MLEIFYTNQFKKDFKKAKKQGKNLEKLKEVLVLLQEQQTLPPKYKDHALTGNYIGTRECHIEPDWLLIYKIDGDKLILTL
ARIGSHSELFR

Download         Length: 276 bp

Antitoxin


Download         Length: 89 a.a.        Molecular weight: 9772.09 Da        Isoelectric Point: 4.4791

>AT259347 WP_002369771.1 NZ_CP104856:390879-391145 [Enterococcus faecalis]
VATTKKKPIHVNVDENLKEEAEQLFDDLGLNMTSAITIFLKQSINEQAIPFMINKGNKETLQALKDIKEGNVHGGFSSVE
DLMEDLNA

Download         Length: 267 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0M2AEA7

Antitoxin

Source ID Structure
AlphaFold DB A0A0M2AED7

References