Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | spoIISABC/SpoIISA-SpoIISB |
Location | 1316344..1317260 | Replicon | chromosome |
Accession | NZ_CP104855 | ||
Organism | Bacillus subtilis strain TY-1 |
Toxin (Protein)
Gene name | spoIISA | Uniprot ID | O34853 |
Locus tag | N6G78_RS06960 | Protein ID | WP_003244695.1 |
Coordinates | 1316514..1317260 (-) | Length | 249 a.a. |
Antitoxin (Protein)
Gene name | spoIISB | Uniprot ID | G4EXD8 |
Locus tag | N6G78_RS06955 | Protein ID | WP_003232646.1 |
Coordinates | 1316344..1316514 (-) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N6G78_RS06920 (N6G78_06920) | 1313203..1313532 | + | 330 | WP_015483132.1 | XkdW family protein | - |
N6G78_RS06925 (N6G78_06925) | 1313529..1313693 | + | 165 | WP_014479563.1 | XkdX family protein | - |
N6G78_RS06930 (N6G78_06930) | 1313740..1314579 | + | 840 | WP_015383447.1 | phage-like element PBSX protein XepA | - |
N6G78_RS06935 (N6G78_06935) | 1314632..1314901 | + | 270 | WP_015252265.1 | hemolysin XhlA family protein | - |
N6G78_RS06940 (N6G78_06940) | 1314914..1315177 | + | 264 | WP_015483133.1 | phage holin | - |
N6G78_RS06945 (N6G78_06945) | 1315190..1316083 | + | 894 | WP_015483134.1 | N-acetylmuramoyl-L-alanine amidase | - |
N6G78_RS06950 (N6G78_06950) | 1316121..1316258 | - | 138 | WP_003232648.1 | three component toxin-antitoxin-antitoxin system antitoxin SpoIISC | - |
N6G78_RS06955 (N6G78_06955) | 1316344..1316514 | - | 171 | WP_003232646.1 | three component toxin-antitoxin-antitoxin system antitoxin SpoIISB | Antitoxin |
N6G78_RS06960 (N6G78_06960) | 1316514..1317260 | - | 747 | WP_003244695.1 | toxin-antitoxin-antitoxin system toxin SpoIISA | Toxin |
N6G78_RS06965 (N6G78_06965) | 1317370..1318371 | - | 1002 | WP_003232642.1 | inorganic phosphate transporter | - |
N6G78_RS06970 (N6G78_06970) | 1318384..1319001 | - | 618 | WP_003218470.1 | DUF47 domain-containing protein | - |
N6G78_RS06975 (N6G78_06975) | 1319277..1320593 | - | 1317 | WP_015383450.1 | serine/threonine exchanger | - |
N6G78_RS06980 (N6G78_06980) | 1320982..1321932 | + | 951 | WP_015383451.1 | ring-cleaving dioxygenase | - |
N6G78_RS06985 (N6G78_06985) | 1322034..1322141 | + | 108 | Protein_1312 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 1282326..1325660 | 43334 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 249 a.a. Molecular weight: 29061.50 Da Isoelectric Point: 4.6191
>T259345 WP_003244695.1 NZ_CP104855:c1317260-1316514 [Bacillus subtilis]
MVLFFQIMVWCIVAGLGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMVYWTYEPTSLFTHWERYLIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLNRLKTYQYLLKNEPIHVYYGSIDAYAEGIDKLLKTYADKMNLTASL
CHYSTQADKDRLTEHMDDPADVQTRLDRKDVYYDQYGKVVLIPFTIETQNYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
MVLFFQIMVWCIVAGLGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMVYWTYEPTSLFTHWERYLIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLNRLKTYQYLLKNEPIHVYYGSIDAYAEGIDKLLKTYADKMNLTASL
CHYSTQADKDRLTEHMDDPADVQTRLDRKDVYYDQYGKVVLIPFTIETQNYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
Download Length: 747 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|