Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 509770..510406 | Replicon | chromosome |
Accession | NZ_CP104855 | ||
Organism | Bacillus subtilis strain TY-1 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | G4NU33 |
Locus tag | N6G78_RS02600 | Protein ID | WP_003156187.1 |
Coordinates | 510056..510406 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | G4NU32 |
Locus tag | N6G78_RS02595 | Protein ID | WP_003225183.1 |
Coordinates | 509770..510051 (+) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N6G78_RS02575 (N6G78_02575) | 506129..506728 | - | 600 | WP_015482831.1 | rhomboid family intramembrane serine protease | - |
N6G78_RS02580 (N6G78_02580) | 506823..507188 | + | 366 | WP_015252768.1 | holo-ACP synthase | - |
N6G78_RS02585 (N6G78_02585) | 507354..508370 | + | 1017 | WP_080030712.1 | outer membrane lipoprotein carrier protein LolA | - |
N6G78_RS02590 (N6G78_02590) | 508485..509654 | + | 1170 | WP_015382833.1 | alanine racemase | - |
N6G78_RS02595 (N6G78_02595) | 509770..510051 | + | 282 | WP_003225183.1 | type II toxin-antitoxin system antitoxin EndoAI | Antitoxin |
N6G78_RS02600 (N6G78_02600) | 510056..510406 | + | 351 | WP_003156187.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
N6G78_RS02605 (N6G78_02605) | 510522..511346 | + | 825 | WP_009966610.1 | RsbT co-antagonist protein RsbRA | - |
N6G78_RS02610 (N6G78_02610) | 511351..511716 | + | 366 | WP_003225190.1 | RsbT antagonist protein RsbS | - |
N6G78_RS02615 (N6G78_02615) | 511720..512121 | + | 402 | WP_003246640.1 | serine/threonine-protein kinase RsbT | - |
N6G78_RS02620 (N6G78_02620) | 512133..513140 | + | 1008 | WP_003234295.1 | phosphoserine phosphatase RsbU | - |
N6G78_RS02625 (N6G78_02625) | 513202..513531 | + | 330 | WP_003234298.1 | anti-sigma factor antagonist RsbV | - |
N6G78_RS02630 (N6G78_02630) | 513528..514010 | + | 483 | WP_003234299.1 | anti-sigma B factor RsbW | - |
N6G78_RS02635 (N6G78_02635) | 513976..514764 | + | 789 | WP_015482833.1 | RNA polymerase sigma factor SigB | - |
N6G78_RS02640 (N6G78_02640) | 514764..515363 | + | 600 | WP_015382836.1 | phosphoserine phosphatase RsbX | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12977.98 Da Isoelectric Point: 4.8781
>T259344 WP_003156187.1 NZ_CP104855:510056-510406 [Bacillus subtilis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|