Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 84765..85408 | Replicon | plasmid pHN4E2-NDM5 |
Accession | NZ_CP104852 | ||
Organism | Escherichia coli strain GYX208DH4E-2 |
Toxin (Protein)
Gene name | vagD | Uniprot ID | B1LRW4 |
Locus tag | N6H16_RS23985 | Protein ID | WP_001044768.1 |
Coordinates | 84992..85408 (+) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | D2WFK3 |
Locus tag | N6H16_RS23980 | Protein ID | WP_001261287.1 |
Coordinates | 84765..84995 (+) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N6H16_RS23970 (79943) | 79943..81076 | - | 1134 | WP_000545983.1 | DUF3800 domain-containing protein | - |
N6H16_RS23975 (81339) | 81339..84458 | - | 3120 | WP_023909028.1 | hypothetical protein | - |
N6H16_RS23980 (84765) | 84765..84995 | + | 231 | WP_001261287.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
N6H16_RS23985 (84992) | 84992..85408 | + | 417 | WP_001044768.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
N6H16_RS23990 (85570) | 85570..87708 | - | 2139 | WP_000350635.1 | AAA family ATPase | - |
N6H16_RS23995 (88173) | 88173..89168 | + | 996 | WP_000246636.1 | hypothetical protein | - |
N6H16_RS24000 (89211) | 89211..90104 | + | 894 | WP_001553853.1 | S-4TM family putative pore-forming effector | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | tet(B) / sul1 / qacE / aadA2 / dfrA12 / blaNDM-5 / aadA5 / blaTEM-1B / aac(3)-IId / mph(A) / aph(6)-Id / aph(3'')-Ib / sul2 / blaOXA-1 / aac(6')-Ib-cr | - | 1..99713 | 99713 | |
- | flank | IS/Tn | - | - | 90241..90744 | 503 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15197.66 Da Isoelectric Point: 7.7805
>T259343 WP_001044768.1 NZ_CP104852:84992-85408 [Escherichia coli]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDEFCARLDAILPWDRA
AVDATTKIKVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPDLVLEDWVK
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDEFCARLDAILPWDRA
AVDATTKIKVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPDLVLEDWVK
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A606Q844 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QFC4 |