Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 2899814..2900658 Replicon chromosome
Accession NZ_CP104851
Organism Escherichia coli strain GYX208DH4E-2

Toxin (Protein)


Gene name yeeV Uniprot ID B1LJY4
Locus tag N6H16_RS14115 Protein ID WP_000854686.1
Coordinates 2899814..2900197 (-) Length 128 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A8E0J1S3
Locus tag N6H16_RS14120 Protein ID WP_001285602.1
Coordinates 2900278..2900658 (-) Length 127 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N6H16_RS14075 (2894817) 2894817..2895308 - 492 WP_001297187.1 DUF1097 domain-containing protein -
N6H16_RS14080 (2895410) 2895410..2895964 - 555 WP_001001902.1 molecular chaperone YcdY -
N6H16_RS14085 (2895988) 2895988..2896725 - 738 WP_000283664.1 zinc-binding phosphatase -
N6H16_RS14090 (2896780) 2896780..2897718 - 939 WP_000351311.1 glyoxylate/hydroxypyruvate reductase GhrA -
N6H16_RS14100 (2898189) 2898189..2899030 - 842 Protein_2764 DUF4942 domain-containing protein -
N6H16_RS14105 (2899115) 2899115..2899312 - 198 WP_000839253.1 DUF957 domain-containing protein -
N6H16_RS14110 (2899329) 2899329..2899817 - 489 WP_032180032.1 DUF5983 family protein -
N6H16_RS14115 (2899814) 2899814..2900197 - 384 WP_000854686.1 TA system toxin CbtA family protein Toxin
N6H16_RS14120 (2900278) 2900278..2900658 - 381 WP_001285602.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
N6H16_RS14125 (2900669) 2900669..2901352 - 684 WP_000086768.1 hypothetical protein -
N6H16_RS14130 (2901371) 2901371..2901592 - 222 WP_000692298.1 DUF987 domain-containing protein -
N6H16_RS14135 (2901655) 2901655..2902131 - 477 WP_001186726.1 RadC family protein -
N6H16_RS14140 (2902147) 2902147..2902632 - 486 WP_000214307.1 antirestriction protein -
N6H16_RS14145 (2902724) 2902724..2903545 - 822 WP_001761104.1 DUF932 domain-containing protein -
N6H16_RS14150 (2903646) 2903646..2903854 - 209 Protein_2774 DUF905 family protein -
N6H16_RS14155 (2903955) 2903955..2904410 - 456 WP_000581506.1 IrmA family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island blaCMY-2 csgB / csgD / csgE / csgF / csgG 2891199..2947165 55966


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-113)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 128 a.a.        Molecular weight: 14272.28 Da        Isoelectric Point: 6.8614

>T259334 WP_000854686.1 NZ_CP104851:c2900197-2899814 [Escherichia coli]
MKTLPDTHVRAASRCPSPVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYVLVRTDQPGF
SAGAPSSQLINSIDILRARRATGLMTRDNYRMVNNITLGKHPEEAKQ

Download         Length: 384 bp

Antitoxin


Download         Length: 127 a.a.        Molecular weight: 13938.69 Da        Isoelectric Point: 5.0823

>AT259334 WP_001285602.1 NZ_CP104851:c2900658-2900278 [Escherichia coli]
VSDTLPGTTLPDDNKDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSNADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCDADTLGSCGYVYLAVYPATETESNPPE

Download         Length: 381 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References