Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 1869185..1870017 | Replicon | chromosome |
| Accession | NZ_CP104851 | ||
| Organism | Escherichia coli strain GYX208DH4E-2 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A0Q2Y5N3 |
| Locus tag | N6H16_RS09000 | Protein ID | WP_001514886.1 |
| Coordinates | 1869185..1869559 (-) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A7U9IW59 |
| Locus tag | N6H16_RS09005 | Protein ID | WP_001360327.1 |
| Coordinates | 1869649..1870017 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N6H16_RS08965 (1864701) | 1864701..1865174 | + | 474 | WP_001105385.1 | DNA gyrase inhibitor SbmC | - |
| N6H16_RS08970 (1865373) | 1865373..1866431 | + | 1059 | WP_032181141.1 | FUSC family protein | - |
| N6H16_RS08975 (1866603) | 1866603..1866932 | + | 330 | WP_000450409.1 | DUF496 family protein | - |
| N6H16_RS08980 (1867033) | 1867033..1867299 | - | 267 | WP_063121129.1 | EutP/PduV family microcompartment system protein | - |
| N6H16_RS08985 (1867669) | 1867669..1868040 | - | 372 | WP_001295631.1 | IS110 family transposase | - |
| N6H16_RS08990 (1868856) | 1868856..1868936 | - | 81 | Protein_1759 | hypothetical protein | - |
| N6H16_RS08995 (1869036) | 1869036..1869188 | - | 153 | Protein_1760 | DUF5983 family protein | - |
| N6H16_RS09000 (1869185) | 1869185..1869559 | - | 375 | WP_001514886.1 | TA system toxin CbtA family protein | Toxin |
| N6H16_RS09005 (1869649) | 1869649..1870017 | - | 369 | WP_001360327.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| N6H16_RS09010 (1870067) | 1870067..1870219 | - | 153 | WP_280984867.1 | DUF905 family protein | - |
| N6H16_RS09015 (1870290) | 1870290..1873136 | - | 2847 | WP_213845699.1 | Ag43/Cah family autotransporter adhesin | - |
| N6H16_RS09020 (1873426) | 1873426..1874967 | + | 1542 | WP_001298859.1 | IS21-like element ISEc12 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1844948..1875728 | 30780 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13930.91 Da Isoelectric Point: 7.2909
>T259328 WP_001514886.1 NZ_CP104851:c1869559-1869185 [Escherichia coli]
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYGLTLNDTPFVDERVIEQHIEAGISLCDAVNFLVEKYALVRTDQSGF
SAGASSQLINSIDILRARRATGLMTRHNYRTVNNITLGKYPEAK
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYGLTLNDTPFVDERVIEQHIEAGISLCDAVNFLVEKYALVRTDQSGF
SAGASSQLINSIDILRARRATGLMTRHNYRTVNNITLGKYPEAK
Download Length: 375 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13593.34 Da Isoelectric Point: 5.9598
>AT259328 WP_001360327.1 NZ_CP104851:c1870017-1869649 [Escherichia coli]
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0Q2Y5N3 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9IW59 |