Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 1344557..1345182 | Replicon | chromosome |
Accession | NZ_CP104851 | ||
Organism | Escherichia coli strain GYX208DH4E-2 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | N6H16_RS06565 | Protein ID | WP_000911330.1 |
Coordinates | 1344784..1345182 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | U9XQV3 |
Locus tag | N6H16_RS06560 | Protein ID | WP_000450524.1 |
Coordinates | 1344557..1344784 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N6H16_RS06535 (1340360) | 1340360..1340830 | - | 471 | WP_001068682.1 | thioredoxin-dependent thiol peroxidase | - |
N6H16_RS06540 (1340830) | 1340830..1341402 | - | 573 | WP_000176187.1 | glycine cleavage system transcriptional repressor | - |
N6H16_RS06545 (1341548) | 1341548..1342426 | + | 879 | WP_001295469.1 | 4-hydroxy-tetrahydrodipicolinate synthase | - |
N6H16_RS06550 (1342443) | 1342443..1343477 | + | 1035 | WP_001297320.1 | outer membrane protein assembly factor BamC | - |
N6H16_RS06555 (1343690) | 1343690..1344403 | + | 714 | WP_001295467.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
N6H16_RS06560 (1344557) | 1344557..1344784 | + | 228 | WP_000450524.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
N6H16_RS06565 (1344784) | 1344784..1345182 | + | 399 | WP_000911330.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
N6H16_RS06570 (1345329) | 1345329..1346192 | + | 864 | WP_001267507.1 | neutral zinc metallopeptidase | - |
N6H16_RS06575 (1346207) | 1346207..1348222 | + | 2016 | WP_000829323.1 | tRNA cytosine(34) acetyltransferase TmcA | - |
N6H16_RS06580 (1348296) | 1348296..1348637 | + | 342 | Protein_1285 | esterase | - |
N6H16_RS06585 (1348719) | 1348719..1349465 | - | 747 | WP_053906593.1 | IS21-like element ISEc12 family helper ATPase IstB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14894.25 Da Isoelectric Point: 9.2216
>T259326 WP_000911330.1 NZ_CP104851:1344784-1345182 [Escherichia coli]
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|