Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-Phd
Location 31731..32332 Replicon plasmid unnamed1
Accession NZ_CP104849
Organism Escherichia coli strain DFK.1

Toxin (Protein)


Gene name doc Uniprot ID V0AJ64
Locus tag N7218_RS25070 Protein ID WP_001216034.1
Coordinates 31731..32111 (-) Length 127 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID U9YQH9
Locus tag N7218_RS25075 Protein ID WP_001190712.1
Coordinates 32111..32332 (-) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N7218_RS25035 (26782) 26782..27714 - 933 WP_000081352.1 homocysteine S-methyltransferase -
N7218_RS25040 (27701) 27701..29104 - 1404 WP_001373486.1 S-methylmethionine permease -
N7218_RS25045 (29348) 29348..30328 + 981 WP_000019407.1 IS5-like element IS5 family transposase -
N7218_RS25050 (30538) 30538..30873 + 336 WP_169329198.1 type I deoxyribonuclease HsdR -
N7218_RS25055 (30823) 30823..31236 - 414 Protein_45 integrase core domain-containing protein -
N7218_RS25060 (31241) 31241..31519 - 279 Protein_46 pdcB -
N7218_RS25065 (31547) 31547..31726 - 180 WP_001513661.1 hypothetical protein -
N7218_RS25070 (31731) 31731..32111 - 381 WP_001216034.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
N7218_RS25075 (32111) 32111..32332 - 222 WP_001190712.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
N7218_RS25080 (32515) 32515..32631 + 117 Protein_50 type I restriction endonuclease subunit M -
N7218_RS25085 (32687) 32687..33384 + 698 WP_103215986.1 IS1-like element IS1A family transposase -
N7218_RS25090 (33521) 33521..34414 - 894 WP_001553853.1 S-4TM family putative pore-forming effector -
N7218_RS25095 (34457) 34457..35452 - 996 WP_000246636.1 hypothetical protein -
N7218_RS25100 (36160) 36160..36378 + 219 WP_000813634.1 type II toxin-antitoxin system antitoxin CcdA -
N7218_RS25105 (36380) 36380..36685 + 306 WP_001159868.1 type II toxin-antitoxin system toxin CcdB -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid blaTEM-1B - 1..85007 85007
- inside IScluster/Tn blaTEM-1B - 12637..33384 20747


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(2-123)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-51)


Sequences

Toxin        


Download         Length: 127 a.a.        Molecular weight: 13615.32 Da        Isoelectric Point: 5.1514

>T259313 WP_001216034.1 NZ_CP104849:c32111-31731 [Escherichia coli]
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE

Download         Length: 381 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8133.10 Da        Isoelectric Point: 4.7708

>AT259313 WP_001190712.1 NZ_CP104849:c32332-32111 [Escherichia coli]
MQSINFRTARGNLSEVLNNVEAGEEVEITRRGREPAVIVSKATFEAYKKAALDAEFASLFDTLDSTNKELVNR

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB V0AJ64

Antitoxin

Source ID Structure
AlphaFold DB A0A829CJB6

References