Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 4240110..4240764 | Replicon | chromosome |
| Accession | NZ_CP104848 | ||
| Organism | Escherichia coli strain DFK.1 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | F4T2L4 |
| Locus tag | N7218_RS20895 | Protein ID | WP_000244765.1 |
| Coordinates | 4240110..4240517 (-) | Length | 136 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | F4T2L5 |
| Locus tag | N7218_RS20900 | Protein ID | WP_000354050.1 |
| Coordinates | 4240498..4240764 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N7218_RS20875 (4236067) | 4236067..4237800 | - | 1734 | WP_000813195.1 | single-stranded-DNA-specific exonuclease RecJ | - |
| N7218_RS20880 (4237806) | 4237806..4238516 | - | 711 | WP_000715230.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| N7218_RS20885 (4238541) | 4238541..4239437 | - | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
| N7218_RS20890 (4239549) | 4239549..4240070 | + | 522 | WP_001055874.1 | flavodoxin FldB | - |
| N7218_RS20895 (4240110) | 4240110..4240517 | - | 408 | WP_000244765.1 | protein YgfX | Toxin |
| N7218_RS20900 (4240498) | 4240498..4240764 | - | 267 | WP_000354050.1 | FAD assembly factor SdhE | Antitoxin |
| N7218_RS20905 (4241007) | 4241007..4241987 | + | 981 | WP_000886084.1 | tRNA-modifying protein YgfZ | - |
| N7218_RS20910 (4242064) | 4242064..4242723 | - | 660 | WP_000250275.1 | hemolysin III family protein | - |
| N7218_RS20915 (4242887) | 4242887..4243198 | - | 312 | WP_001182956.1 | N(4)-acetylcytidine aminohydrolase | - |
| N7218_RS20920 (4243243) | 4243243..4244676 | + | 1434 | WP_001296350.1 | 6-phospho-beta-glucosidase BglA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16043.95 Da Isoelectric Point: 11.5202
>T259309 WP_000244765.1 NZ_CP104848:c4240517-4240110 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLIPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLIPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A454A7D7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A061L3F4 |