Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 3306043..3306874 Replicon chromosome
Accession NZ_CP104848
Organism Escherichia coli strain DFK.1

Toxin (Protein)


Gene name yeeV Uniprot ID A0A066T988
Locus tag N7218_RS16690 Protein ID WP_000854815.1
Coordinates 3306500..3306874 (+) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A061Y7A8
Locus tag N7218_RS16685 Protein ID WP_001280918.1
Coordinates 3306043..3306411 (+) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N7218_RS16640 (3301132) 3301132..3301878 + 747 WP_001016257.1 IS21-like element ISEc12 family helper ATPase IstB -
N7218_RS16645 (3301961) 3301961..3302311 + 351 Protein_3272 hypothetical protein -
N7218_RS16650 (3302327) 3302327..3302737 + 411 WP_000846703.1 hypothetical protein -
N7218_RS16655 (3302958) 3302958..3303776 + 819 WP_001542275.1 DUF932 domain-containing protein -
N7218_RS16660 (3303776) 3303776..3304021 + 246 WP_001164966.1 hypothetical protein -
N7218_RS16665 (3304115) 3304115..3304588 + 474 WP_001542276.1 antirestriction protein -
N7218_RS16670 (3304604) 3304604..3305080 + 477 WP_001186200.1 RadC family protein -
N7218_RS16675 (3305143) 3305143..3305364 + 222 WP_000692345.1 DUF987 domain-containing protein -
N7218_RS16680 (3305383) 3305383..3306027 + 645 WP_000086752.1 hypothetical protein -
N7218_RS16685 (3306043) 3306043..3306411 + 369 WP_001280918.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
N7218_RS16690 (3306500) 3306500..3306874 + 375 WP_000854815.1 type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA Toxin
N7218_RS16695 (3306871) 3306871..3307065 + 195 WP_000988600.1 DUF5983 family protein -
N7218_RS16700 (3307111) 3307111..3307191 + 81 Protein_3283 hypothetical protein -
N7218_RS16705 (3307480) 3307480..3307560 - 81 WP_023441679.1 hypothetical protein -
N7218_RS16710 (3307539) 3307539..3307862 + 324 WP_225469267.1 EutP/PduV family microcompartment system protein -
N7218_RS16715 (3307963) 3307963..3308292 - 330 WP_000450409.1 DUF496 family protein -
N7218_RS16720 (3308464) 3308464..3309522 - 1059 WP_001200889.1 FUSC family protein -
N7218_RS16725 (3309720) 3309720..3310193 - 474 WP_001105368.1 DNA gyrase inhibitor SbmC -
N7218_RS16730 (3310312) 3310312..3311478 - 1167 WP_001296209.1 serine-type D-Ala-D-Ala carboxypeptidase DacD -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(19-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13829.83 Da        Isoelectric Point: 7.1326

>T259307 WP_000854815.1 NZ_CP104848:3306500-3306874 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTSDNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13811.70 Da        Isoelectric Point: 6.4767

>AT259307 WP_001280918.1 NZ_CP104848:3306043-3306411 [Escherichia coli]
VSDKLHETNYPDDHNDRLWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A066T988

Antitoxin

Source ID Structure
AlphaFold DB A0A061Y7A8

References