Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 1575197..1575815 | Replicon | chromosome |
| Accession | NZ_CP104848 | ||
| Organism | Escherichia coli strain DFK.1 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | H5UYE2 |
| Locus tag | N7218_RS07775 | Protein ID | WP_001291435.1 |
| Coordinates | 1575197..1575415 (-) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | S1PTH5 |
| Locus tag | N7218_RS07780 | Protein ID | WP_000344800.1 |
| Coordinates | 1575441..1575815 (-) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N7218_RS07740 (1570484) | 1570484..1571056 | + | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
| N7218_RS07745 (1571087) | 1571087..1571398 | - | 312 | WP_000409908.1 | MGMT family protein | - |
| N7218_RS07755 (1571777) | 1571777..1572130 | + | 354 | WP_000878135.1 | DUF1428 family protein | - |
| N7218_RS07760 (1572172) | 1572172..1573722 | - | 1551 | WP_001385227.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
| N7218_RS07765 (1573886) | 1573886..1574356 | - | 471 | WP_000136192.1 | YlaC family protein | - |
| N7218_RS07770 (1574472) | 1574472..1575023 | - | 552 | WP_000102539.1 | maltose O-acetyltransferase | - |
| N7218_RS07775 (1575197) | 1575197..1575415 | - | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
| N7218_RS07780 (1575441) | 1575441..1575815 | - | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
| N7218_RS07785 (1576361) | 1576361..1579510 | - | 3150 | WP_001132478.1 | efflux RND transporter permease AcrB | - |
| N7218_RS07790 (1579533) | 1579533..1580726 | - | 1194 | WP_001295833.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T259296 WP_001291435.1 NZ_CP104848:c1575415-1575197 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT259296 WP_000344800.1 NZ_CP104848:c1575815-1575441 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 2MW2 | |
| PDB | 1JW2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9QBQ5 |