Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | phd-doc/Doc-Phd |
| Location | 1145987..1146588 | Replicon | chromosome |
| Accession | NZ_CP104848 | ||
| Organism | Escherichia coli strain DFK.1 | ||
Toxin (Protein)
| Gene name | doc | Uniprot ID | V0AJ64 |
| Locus tag | N7218_RS05695 | Protein ID | WP_001216034.1 |
| Coordinates | 1145987..1146367 (-) | Length | 127 a.a. |
Antitoxin (Protein)
| Gene name | phd | Uniprot ID | U9YQH9 |
| Locus tag | N7218_RS05700 | Protein ID | WP_001190712.1 |
| Coordinates | 1146367..1146588 (-) | Length | 74 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N7218_RS05660 (1141038) | 1141038..1141970 | - | 933 | WP_000081352.1 | homocysteine S-methyltransferase | - |
| N7218_RS05665 (1141957) | 1141957..1143360 | - | 1404 | WP_001373486.1 | S-methylmethionine permease | - |
| N7218_RS05670 (1143604) | 1143604..1144584 | + | 981 | WP_000019407.1 | IS5-like element IS5 family transposase | - |
| N7218_RS05675 (1144794) | 1144794..1145129 | + | 336 | WP_169329198.1 | type I deoxyribonuclease HsdR | - |
| N7218_RS05680 (1145079) | 1145079..1145492 | - | 414 | Protein_1119 | integrase core domain-containing protein | - |
| N7218_RS05685 (1145497) | 1145497..1145775 | - | 279 | Protein_1120 | pdcB | - |
| N7218_RS05690 (1145803) | 1145803..1145982 | - | 180 | WP_001513661.1 | hypothetical protein | - |
| N7218_RS05695 (1145987) | 1145987..1146367 | - | 381 | WP_001216034.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
| N7218_RS05700 (1146367) | 1146367..1146588 | - | 222 | WP_001190712.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| N7218_RS05705 (1146771) | 1146771..1146887 | + | 117 | Protein_1124 | type I restriction endonuclease subunit M | - |
| N7218_RS05710 (1146943) | 1146943..1147640 | + | 698 | WP_103215986.1 | IS1-like element IS1A family transposase | - |
| N7218_RS05715 (1147722) | 1147722..1148159 | + | 438 | WP_001220296.1 | tripartite tricarboxylate transporter TctB family protein | - |
| N7218_RS05720 (1148169) | 1148169..1149656 | + | 1488 | WP_000353207.1 | tripartite tricarboxylate transporter permease | - |
| N7218_RS05725 (1149840) | 1149840..1150604 | + | 765 | WP_001148411.1 | DedA family protein | - |
| N7218_RS05730 (1150718) | 1150718..1151416 | - | 699 | WP_000916271.1 | thiamine ABC transporter ATP-binding protein ThiQ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1138887..1151416 | 12529 | |
| - | inside | IScluster/Tn | - | - | 1139887..1147640 | 7753 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 127 a.a. Molecular weight: 13615.32 Da Isoelectric Point: 5.1514
>T259294 WP_001216034.1 NZ_CP104848:c1146367-1145987 [Escherichia coli]
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE
Download Length: 381 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | V0AJ64 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CJB6 |