Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-Phd
Location 1145987..1146588 Replicon chromosome
Accession NZ_CP104848
Organism Escherichia coli strain DFK.1

Toxin (Protein)


Gene name doc Uniprot ID V0AJ64
Locus tag N7218_RS05695 Protein ID WP_001216034.1
Coordinates 1145987..1146367 (-) Length 127 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID U9YQH9
Locus tag N7218_RS05700 Protein ID WP_001190712.1
Coordinates 1146367..1146588 (-) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N7218_RS05660 (1141038) 1141038..1141970 - 933 WP_000081352.1 homocysteine S-methyltransferase -
N7218_RS05665 (1141957) 1141957..1143360 - 1404 WP_001373486.1 S-methylmethionine permease -
N7218_RS05670 (1143604) 1143604..1144584 + 981 WP_000019407.1 IS5-like element IS5 family transposase -
N7218_RS05675 (1144794) 1144794..1145129 + 336 WP_169329198.1 type I deoxyribonuclease HsdR -
N7218_RS05680 (1145079) 1145079..1145492 - 414 Protein_1119 integrase core domain-containing protein -
N7218_RS05685 (1145497) 1145497..1145775 - 279 Protein_1120 pdcB -
N7218_RS05690 (1145803) 1145803..1145982 - 180 WP_001513661.1 hypothetical protein -
N7218_RS05695 (1145987) 1145987..1146367 - 381 WP_001216034.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
N7218_RS05700 (1146367) 1146367..1146588 - 222 WP_001190712.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
N7218_RS05705 (1146771) 1146771..1146887 + 117 Protein_1124 type I restriction endonuclease subunit M -
N7218_RS05710 (1146943) 1146943..1147640 + 698 WP_103215986.1 IS1-like element IS1A family transposase -
N7218_RS05715 (1147722) 1147722..1148159 + 438 WP_001220296.1 tripartite tricarboxylate transporter TctB family protein -
N7218_RS05720 (1148169) 1148169..1149656 + 1488 WP_000353207.1 tripartite tricarboxylate transporter permease -
N7218_RS05725 (1149840) 1149840..1150604 + 765 WP_001148411.1 DedA family protein -
N7218_RS05730 (1150718) 1150718..1151416 - 699 WP_000916271.1 thiamine ABC transporter ATP-binding protein ThiQ -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1138887..1151416 12529
- inside IScluster/Tn - - 1139887..1147640 7753


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(2-123)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-51)


Sequences

Toxin        


Download         Length: 127 a.a.        Molecular weight: 13615.32 Da        Isoelectric Point: 5.1514

>T259294 WP_001216034.1 NZ_CP104848:c1146367-1145987 [Escherichia coli]
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE

Download         Length: 381 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8133.10 Da        Isoelectric Point: 4.7708

>AT259294 WP_001190712.1 NZ_CP104848:c1146588-1146367 [Escherichia coli]
MQSINFRTARGNLSEVLNNVEAGEEVEITRRGREPAVIVSKATFEAYKKAALDAEFASLFDTLDSTNKELVNR

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB V0AJ64

Antitoxin

Source ID Structure
AlphaFold DB A0A829CJB6

References