Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 871735..872570 | Replicon | chromosome |
| Accession | NZ_CP104848 | ||
| Organism | Escherichia coli strain DFK.1 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A0J2AEA6 |
| Locus tag | N7218_RS04290 | Protein ID | WP_000854759.1 |
| Coordinates | 872193..872570 (+) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | S1NM52 |
| Locus tag | N7218_RS04285 | Protein ID | WP_001295723.1 |
| Coordinates | 871735..872103 (+) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N7218_RS04260 (868851) | 868851..869046 | + | 196 | Protein_838 | DUF905 family protein | - |
| N7218_RS04265 (869164) | 869164..869982 | + | 819 | WP_001234738.1 | DUF932 domain-containing protein | - |
| N7218_RS04270 (870323) | 870323..870796 | + | 474 | WP_001542276.1 | antirestriction protein | - |
| N7218_RS04275 (870812) | 870812..871288 | + | 477 | WP_059333688.1 | RadC family protein | - |
| N7218_RS04280 (871351) | 871351..871572 | + | 222 | WP_000692345.1 | DUF987 domain-containing protein | - |
| N7218_RS04285 (871735) | 871735..872103 | + | 369 | WP_001295723.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| N7218_RS04290 (872193) | 872193..872570 | + | 378 | WP_000854759.1 | TA system toxin CbtA family protein | Toxin |
| N7218_RS04295 (872567) | 872567..873055 | + | 489 | WP_000761690.1 | DUF5983 family protein | - |
| N7218_RS04300 (873072) | 873072..873248 | + | 177 | WP_000839286.1 | DUF957 domain-containing protein | - |
| N7218_RS04305 (873354) | 873354..873503 | + | 150 | Protein_847 | hypothetical protein | - |
| N7218_RS04310 (873870) | 873870..874046 | + | 177 | Protein_848 | helix-turn-helix domain-containing protein | - |
| N7218_RS04315 (874837) | 874837..876459 | + | 1623 | WP_001295726.1 | Alw26I/Eco31I/Esp3I family type II restriction adenine-specific DNA-methyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 865934..888033 | 22099 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14144.26 Da Isoelectric Point: 7.3249
>T259291 WP_000854759.1 NZ_CP104848:872193-872570 [Escherichia coli]
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDLPGF
SACTHSQLINSIDILRARRATGLMIRDNYRTVNNITLGKHPEAKR
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDLPGF
SACTHSQLINSIDILRARRATGLMIRDNYRTVNNITLGKHPEAKR
Download Length: 378 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0J2AEA6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | S1NM52 |