Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 821357..822191 | Replicon | chromosome |
| Accession | NZ_CP104848 | ||
| Organism | Escherichia coli strain DFK.1 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | S1PLF5 |
| Locus tag | N7218_RS03995 | Protein ID | WP_000854690.1 |
| Coordinates | 821357..821734 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | S1P7N8 |
| Locus tag | N7218_RS04000 | Protein ID | WP_001305076.1 |
| Coordinates | 821823..822191 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N7218_RS03965 (817751) | 817751..817921 | - | 171 | Protein_779 | IS110 family transposase | - |
| N7218_RS03970 (818338) | 818338..819271 | - | 934 | Protein_780 | nucleotidyl transferase AbiEii/AbiGii toxin family protein | - |
| N7218_RS03975 (819264) | 819264..819659 | - | 396 | WP_000208384.1 | DUF6088 family protein | - |
| N7218_RS03980 (819728) | 819728..820573 | - | 846 | WP_001529401.1 | DUF4942 domain-containing protein | - |
| N7218_RS03985 (820658) | 820658..820855 | - | 198 | WP_000839293.1 | DUF957 domain-containing protein | - |
| N7218_RS03990 (820872) | 820872..821360 | - | 489 | WP_000761699.1 | DUF5983 family protein | - |
| N7218_RS03995 (821357) | 821357..821734 | - | 378 | WP_000854690.1 | TA system toxin CbtA family protein | Toxin |
| N7218_RS04000 (821823) | 821823..822191 | - | 369 | WP_001305076.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| N7218_RS04005 (822241) | 822241..822885 | - | 645 | WP_000094916.1 | hypothetical protein | - |
| N7218_RS04010 (822904) | 822904..823125 | - | 222 | WP_000692329.1 | DUF987 domain-containing protein | - |
| N7218_RS04015 (823188) | 823188..823664 | - | 477 | WP_001186726.1 | RadC family protein | - |
| N7218_RS04020 (823680) | 823680..824165 | - | 486 | WP_000849565.1 | antirestriction protein | - |
| N7218_RS04025 (824220) | 824220..825038 | - | 819 | WP_001234620.1 | DUF932 domain-containing protein | - |
| N7218_RS04030 (825139) | 825139..825372 | - | 234 | WP_000902034.1 | DUF905 family protein | - |
| N7218_RS04035 (825451) | 825451..825801 | - | 351 | Protein_793 | IrmA family protein | - |
| N7218_RS04040 (825885) | 825885..826310 | + | 426 | WP_000422741.1 | transposase | - |
| N7218_RS04045 (826307) | 826307..826657 | + | 351 | WP_000624722.1 | IS66 family insertion sequence element accessory protein TnpB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | blaCTX-M-14 | ugd / kpsS / kpsC / kpsU / kpsD / kpsE / kpsF | 801807..845826 | 44019 | |
| - | flank | IS/Tn | - | - | 817751..817906 | 155 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14057.04 Da Isoelectric Point: 9.1510
>T259290 WP_000854690.1 NZ_CP104848:c821734-821357 [Escherichia coli]
MKTLPDTHVRAASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYAQVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKR
MKTLPDTHVRAASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYAQVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKR
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13560.39 Da Isoelectric Point: 4.7830
>AT259290 WP_001305076.1 NZ_CP104848:c822191-821823 [Escherichia coli]
MSDTLPGTTLPDDNKDLPWWGLPCTVTPCFGACLVQEGNRLHYLADRAGIRGRFSDADAYHPDQAFPLLMKQPELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCDYVYLAVYPTPEMKN
MSDTLPGTTLPDDNKDLPWWGLPCTVTPCFGACLVQEGNRLHYLADRAGIRGRFSDADAYHPDQAFPLLMKQPELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCDYVYLAVYPTPEMKN
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|