Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 821357..822191 Replicon chromosome
Accession NZ_CP104848
Organism Escherichia coli strain DFK.1

Toxin (Protein)


Gene name yeeV Uniprot ID S1PLF5
Locus tag N7218_RS03995 Protein ID WP_000854690.1
Coordinates 821357..821734 (-) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID S1P7N8
Locus tag N7218_RS04000 Protein ID WP_001305076.1
Coordinates 821823..822191 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N7218_RS03965 (817751) 817751..817921 - 171 Protein_779 IS110 family transposase -
N7218_RS03970 (818338) 818338..819271 - 934 Protein_780 nucleotidyl transferase AbiEii/AbiGii toxin family protein -
N7218_RS03975 (819264) 819264..819659 - 396 WP_000208384.1 DUF6088 family protein -
N7218_RS03980 (819728) 819728..820573 - 846 WP_001529401.1 DUF4942 domain-containing protein -
N7218_RS03985 (820658) 820658..820855 - 198 WP_000839293.1 DUF957 domain-containing protein -
N7218_RS03990 (820872) 820872..821360 - 489 WP_000761699.1 DUF5983 family protein -
N7218_RS03995 (821357) 821357..821734 - 378 WP_000854690.1 TA system toxin CbtA family protein Toxin
N7218_RS04000 (821823) 821823..822191 - 369 WP_001305076.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
N7218_RS04005 (822241) 822241..822885 - 645 WP_000094916.1 hypothetical protein -
N7218_RS04010 (822904) 822904..823125 - 222 WP_000692329.1 DUF987 domain-containing protein -
N7218_RS04015 (823188) 823188..823664 - 477 WP_001186726.1 RadC family protein -
N7218_RS04020 (823680) 823680..824165 - 486 WP_000849565.1 antirestriction protein -
N7218_RS04025 (824220) 824220..825038 - 819 WP_001234620.1 DUF932 domain-containing protein -
N7218_RS04030 (825139) 825139..825372 - 234 WP_000902034.1 DUF905 family protein -
N7218_RS04035 (825451) 825451..825801 - 351 Protein_793 IrmA family protein -
N7218_RS04040 (825885) 825885..826310 + 426 WP_000422741.1 transposase -
N7218_RS04045 (826307) 826307..826657 + 351 WP_000624722.1 IS66 family insertion sequence element accessory protein TnpB -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island blaCTX-M-14 ugd / kpsS / kpsC / kpsU / kpsD / kpsE / kpsF 801807..845826 44019
- flank IS/Tn - - 817751..817906 155


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14057.04 Da        Isoelectric Point: 9.1510

>T259290 WP_000854690.1 NZ_CP104848:c821734-821357 [Escherichia coli]
MKTLPDTHVRAASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYAQVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKR

Download         Length: 378 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13560.39 Da        Isoelectric Point: 4.7830

>AT259290 WP_001305076.1 NZ_CP104848:c822191-821823 [Escherichia coli]
MSDTLPGTTLPDDNKDLPWWGLPCTVTPCFGACLVQEGNRLHYLADRAGIRGRFSDADAYHPDQAFPLLMKQPELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCDYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB S1PLF5

Antitoxin

Source ID Structure
AlphaFold DB S1P7N8

References