Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
| Location | 34850..35375 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP104847 | ||
| Organism | Escherichia coli strain DFS.1 | ||
Toxin (Protein)
| Gene name | ccdB | Uniprot ID | V0SSI5 |
| Locus tag | N7219_RS24440 | Protein ID | WP_001159868.1 |
| Coordinates | 35070..35375 (+) | Length | 102 a.a. |
Antitoxin (Protein)
| Gene name | ccdA | Uniprot ID | S1PPD8 |
| Locus tag | N7219_RS24435 | Protein ID | WP_000813634.1 |
| Coordinates | 34850..35068 (+) | Length | 73 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N7219_RS24395 (29931) | 29931..30209 | - | 279 | Protein_42 | pdcB | - |
| N7219_RS24400 (30237) | 30237..30416 | - | 180 | WP_001513661.1 | hypothetical protein | - |
| N7219_RS24405 (30421) | 30421..30801 | - | 381 | WP_001216034.1 | type II toxin-antitoxin system death-on-curing family toxin | - |
| N7219_RS24410 (30801) | 30801..31022 | - | 222 | WP_001190712.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
| N7219_RS24415 (31205) | 31205..31321 | + | 117 | Protein_46 | type I restriction endonuclease subunit M | - |
| N7219_RS24420 (31377) | 31377..32074 | + | 698 | WP_103215986.1 | IS1-like element IS1A family transposase | - |
| N7219_RS24425 (32211) | 32211..33104 | - | 894 | WP_001553853.1 | S-4TM family putative pore-forming effector | - |
| N7219_RS24430 (33147) | 33147..34142 | - | 996 | WP_000246636.1 | hypothetical protein | - |
| N7219_RS24435 (34850) | 34850..35068 | + | 219 | WP_000813634.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
| N7219_RS24440 (35070) | 35070..35375 | + | 306 | WP_001159868.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
| N7219_RS24445 (35376) | 35376..36182 | + | 807 | WP_000016982.1 | site-specific integrase | - |
| N7219_RS24450 (36956) | 36956..37711 | + | 756 | WP_000852146.1 | replication initiation protein RepE | - |
| N7219_RS24455 (38299) | 38299..39465 | + | 1167 | WP_000772446.1 | plasmid-partitioning protein SopA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | blaTEM-1B | - | 1..92732 | 92732 | |
| - | inside | IScluster/Tn | blaTEM-1B | - | 11327..32074 | 20747 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11706.51 Da Isoelectric Point: 6.4674
>T259283 WP_001159868.1 NZ_CP104847:35070-35375 [Escherichia coli]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|