Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-Phd
Location 30421..31022 Replicon plasmid unnamed1
Accession NZ_CP104847
Organism Escherichia coli strain DFS.1

Toxin (Protein)


Gene name doc Uniprot ID V0AJ64
Locus tag N7219_RS24405 Protein ID WP_001216034.1
Coordinates 30421..30801 (-) Length 127 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID U9YQH9
Locus tag N7219_RS24410 Protein ID WP_001190712.1
Coordinates 30801..31022 (-) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N7219_RS24370 (25472) 25472..26404 - 933 WP_000081352.1 homocysteine S-methyltransferase -
N7219_RS24375 (26391) 26391..27794 - 1404 WP_001373486.1 S-methylmethionine permease -
N7219_RS24380 (28038) 28038..29018 + 981 WP_000019407.1 IS5-like element IS5 family transposase -
N7219_RS24385 (29228) 29228..29563 + 336 WP_169329198.1 type I deoxyribonuclease HsdR -
N7219_RS24390 (29513) 29513..29926 - 414 Protein_41 integrase core domain-containing protein -
N7219_RS24395 (29931) 29931..30209 - 279 Protein_42 pdcB -
N7219_RS24400 (30237) 30237..30416 - 180 WP_001513661.1 hypothetical protein -
N7219_RS24405 (30421) 30421..30801 - 381 WP_001216034.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
N7219_RS24410 (30801) 30801..31022 - 222 WP_001190712.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
N7219_RS24415 (31205) 31205..31321 + 117 Protein_46 type I restriction endonuclease subunit M -
N7219_RS24420 (31377) 31377..32074 + 698 WP_103215986.1 IS1-like element IS1A family transposase -
N7219_RS24425 (32211) 32211..33104 - 894 WP_001553853.1 S-4TM family putative pore-forming effector -
N7219_RS24430 (33147) 33147..34142 - 996 WP_000246636.1 hypothetical protein -
N7219_RS24435 (34850) 34850..35068 + 219 WP_000813634.1 type II toxin-antitoxin system antitoxin CcdA -
N7219_RS24440 (35070) 35070..35375 + 306 WP_001159868.1 type II toxin-antitoxin system toxin CcdB -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid blaTEM-1B - 1..92732 92732
- inside IScluster/Tn blaTEM-1B - 11327..32074 20747


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(2-123)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-51)


Sequences

Toxin        


Download         Length: 127 a.a.        Molecular weight: 13615.32 Da        Isoelectric Point: 5.1514

>T259282 WP_001216034.1 NZ_CP104847:c30801-30421 [Escherichia coli]
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE

Download         Length: 381 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8133.10 Da        Isoelectric Point: 4.7708

>AT259282 WP_001190712.1 NZ_CP104847:c31022-30801 [Escherichia coli]
MQSINFRTARGNLSEVLNNVEAGEEVEITRRGREPAVIVSKATFEAYKKAALDAEFASLFDTLDSTNKELVNR

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB V0AJ64

Antitoxin

Source ID Structure
AlphaFold DB A0A829CJB6

References