Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | chpSB/PRK09812-ChpS |
| Location | 4315664..4316259 | Replicon | chromosome |
| Accession | NZ_CP104846 | ||
| Organism | Escherichia coli strain DFS.1 | ||
Toxin (Protein)
| Gene name | chpB | Uniprot ID | U9Y4M4 |
| Locus tag | N7219_RS21250 | Protein ID | WP_000239579.1 |
| Coordinates | 4315664..4316014 (-) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | chpS | Uniprot ID | U9Y2K1 |
| Locus tag | N7219_RS21255 | Protein ID | WP_001223208.1 |
| Coordinates | 4316008..4316259 (-) | Length | 84 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N7219_RS21230 (4311110) | 4311110..4312132 | - | 1023 | WP_001296689.1 | ABC transporter permease | - |
| N7219_RS21235 (4312146) | 4312146..4313648 | - | 1503 | WP_000205813.1 | sugar ABC transporter ATP-binding protein | - |
| N7219_RS21240 (4313788) | 4313788..4314744 | - | 957 | WP_000265933.1 | galactofuranose ABC transporter substrate-binding protein YtfQ | - |
| N7219_RS21245 (4315054) | 4315054..4315584 | + | 531 | WP_000055075.1 | inorganic diphosphatase | - |
| N7219_RS21250 (4315664) | 4315664..4316014 | - | 351 | WP_000239579.1 | endoribonuclease toxin ChpB | Toxin |
| N7219_RS21255 (4316008) | 4316008..4316259 | - | 252 | WP_001223208.1 | type II toxin-antitoxin system antitoxin ChpS | Antitoxin |
| N7219_RS21260 (4316471) | 4316471..4316812 | - | 342 | WP_001219160.1 | gamma-glutamylcyclotransferase | - |
| N7219_RS21265 (4316815) | 4316815..4320594 | - | 3780 | WP_000060945.1 | autotransporter assembly complex protein TamB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12511.45 Da Isoelectric Point: 5.6219
>T259275 WP_000239579.1 NZ_CP104846:c4316014-4315664 [Escherichia coli]
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLRARLAKRIGLAADEVVEEALLRLQAVVE
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLRARLAKRIGLAADEVVEEALLRLQAVVE
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E0Y8A8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9LQ26 |