Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 3186716..3187547 Replicon chromosome
Accession NZ_CP104846
Organism Escherichia coli strain DFS.1

Toxin (Protein)


Gene name yeeV Uniprot ID A0A066T988
Locus tag N7219_RS16050 Protein ID WP_000854815.1
Coordinates 3187173..3187547 (+) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A061Y7A8
Locus tag N7219_RS16045 Protein ID WP_001280918.1
Coordinates 3186716..3187084 (+) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N7219_RS16000 (3181805) 3181805..3182551 + 747 WP_001016257.1 IS21-like element ISEc12 family helper ATPase IstB -
N7219_RS16005 (3182634) 3182634..3182984 + 351 Protein_3144 hypothetical protein -
N7219_RS16010 (3183000) 3183000..3183410 + 411 WP_000846703.1 hypothetical protein -
N7219_RS16015 (3183631) 3183631..3184449 + 819 WP_001542275.1 DUF932 domain-containing protein -
N7219_RS16020 (3184449) 3184449..3184694 + 246 WP_001164966.1 hypothetical protein -
N7219_RS16025 (3184788) 3184788..3185261 + 474 WP_001542276.1 antirestriction protein -
N7219_RS16030 (3185277) 3185277..3185753 + 477 WP_001186200.1 RadC family protein -
N7219_RS16035 (3185816) 3185816..3186037 + 222 WP_000692345.1 DUF987 domain-containing protein -
N7219_RS16040 (3186056) 3186056..3186700 + 645 WP_000086752.1 hypothetical protein -
N7219_RS16045 (3186716) 3186716..3187084 + 369 WP_001280918.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
N7219_RS16050 (3187173) 3187173..3187547 + 375 WP_000854815.1 type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA Toxin
N7219_RS16055 (3187544) 3187544..3187738 + 195 WP_000988600.1 DUF5983 family protein -
N7219_RS16060 (3187784) 3187784..3187864 + 81 Protein_3155 hypothetical protein -
N7219_RS16065 (3188153) 3188153..3188233 - 81 WP_023441679.1 hypothetical protein -
N7219_RS16070 (3188212) 3188212..3188535 + 324 WP_225469267.1 EutP/PduV family microcompartment system protein -
N7219_RS16075 (3188636) 3188636..3188965 - 330 WP_000450409.1 DUF496 family protein -
N7219_RS16080 (3189137) 3189137..3190195 - 1059 WP_001200889.1 FUSC family protein -
N7219_RS16085 (3190393) 3190393..3190866 - 474 WP_001105368.1 DNA gyrase inhibitor SbmC -
N7219_RS16090 (3190985) 3190985..3192151 - 1167 WP_001296209.1 serine-type D-Ala-D-Ala carboxypeptidase DacD -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(19-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13829.83 Da        Isoelectric Point: 7.1326

>T259272 WP_000854815.1 NZ_CP104846:3187173-3187547 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTSDNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13811.70 Da        Isoelectric Point: 6.4767

>AT259272 WP_001280918.1 NZ_CP104846:3186716-3187084 [Escherichia coli]
VSDKLHETNYPDDHNDRLWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A066T988

Antitoxin

Source ID Structure
AlphaFold DB A0A061Y7A8

References