Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 3186716..3187547 | Replicon | chromosome |
Accession | NZ_CP104846 | ||
Organism | Escherichia coli strain DFS.1 |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | A0A066T988 |
Locus tag | N7219_RS16050 | Protein ID | WP_000854815.1 |
Coordinates | 3187173..3187547 (+) | Length | 125 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | A0A061Y7A8 |
Locus tag | N7219_RS16045 | Protein ID | WP_001280918.1 |
Coordinates | 3186716..3187084 (+) | Length | 123 a.a. |
Genomic Context
Location: 3181805..3182551 (747 bp)
Type: Others
Protein ID: WP_001016257.1
Type: Others
Protein ID: WP_001016257.1
Location: 3182634..3182984 (351 bp)
Type: Others
Protein ID: Protein_3144
Type: Others
Protein ID: Protein_3144
Location: 3183000..3183410 (411 bp)
Type: Others
Protein ID: WP_000846703.1
Type: Others
Protein ID: WP_000846703.1
Location: 3183631..3184449 (819 bp)
Type: Others
Protein ID: WP_001542275.1
Type: Others
Protein ID: WP_001542275.1
Location: 3184449..3184694 (246 bp)
Type: Others
Protein ID: WP_001164966.1
Type: Others
Protein ID: WP_001164966.1
Location: 3184788..3185261 (474 bp)
Type: Others
Protein ID: WP_001542276.1
Type: Others
Protein ID: WP_001542276.1
Location: 3185277..3185753 (477 bp)
Type: Others
Protein ID: WP_001186200.1
Type: Others
Protein ID: WP_001186200.1
Location: 3185816..3186037 (222 bp)
Type: Others
Protein ID: WP_000692345.1
Type: Others
Protein ID: WP_000692345.1
Location: 3186056..3186700 (645 bp)
Type: Others
Protein ID: WP_000086752.1
Type: Others
Protein ID: WP_000086752.1
Location: 3186716..3187084 (369 bp)
Type: Antitoxin
Protein ID: WP_001280918.1
Type: Antitoxin
Protein ID: WP_001280918.1
Location: 3187173..3187547 (375 bp)
Type: Toxin
Protein ID: WP_000854815.1
Type: Toxin
Protein ID: WP_000854815.1
Location: 3187544..3187738 (195 bp)
Type: Others
Protein ID: WP_000988600.1
Type: Others
Protein ID: WP_000988600.1
Location: 3187784..3187864 (81 bp)
Type: Others
Protein ID: Protein_3155
Type: Others
Protein ID: Protein_3155
Location: 3188212..3188535 (324 bp)
Type: Others
Protein ID: WP_225469267.1
Type: Others
Protein ID: WP_225469267.1
Location: 3188153..3188233 (81 bp)
Type: Others
Protein ID: WP_023441679.1
Type: Others
Protein ID: WP_023441679.1
Location: 3188636..3188965 (330 bp)
Type: Others
Protein ID: WP_000450409.1
Type: Others
Protein ID: WP_000450409.1
Location: 3189137..3190195 (1059 bp)
Type: Others
Protein ID: WP_001200889.1
Type: Others
Protein ID: WP_001200889.1
Location: 3190393..3190866 (474 bp)
Type: Others
Protein ID: WP_001105368.1
Type: Others
Protein ID: WP_001105368.1
Location: 3190985..3192151 (1167 bp)
Type: Others
Protein ID: WP_001296209.1
Type: Others
Protein ID: WP_001296209.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N7219_RS16000 (3181805) | 3181805..3182551 | + | 747 | WP_001016257.1 | IS21-like element ISEc12 family helper ATPase IstB | - |
N7219_RS16005 (3182634) | 3182634..3182984 | + | 351 | Protein_3144 | hypothetical protein | - |
N7219_RS16010 (3183000) | 3183000..3183410 | + | 411 | WP_000846703.1 | hypothetical protein | - |
N7219_RS16015 (3183631) | 3183631..3184449 | + | 819 | WP_001542275.1 | DUF932 domain-containing protein | - |
N7219_RS16020 (3184449) | 3184449..3184694 | + | 246 | WP_001164966.1 | hypothetical protein | - |
N7219_RS16025 (3184788) | 3184788..3185261 | + | 474 | WP_001542276.1 | antirestriction protein | - |
N7219_RS16030 (3185277) | 3185277..3185753 | + | 477 | WP_001186200.1 | RadC family protein | - |
N7219_RS16035 (3185816) | 3185816..3186037 | + | 222 | WP_000692345.1 | DUF987 domain-containing protein | - |
N7219_RS16040 (3186056) | 3186056..3186700 | + | 645 | WP_000086752.1 | hypothetical protein | - |
N7219_RS16045 (3186716) | 3186716..3187084 | + | 369 | WP_001280918.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
N7219_RS16050 (3187173) | 3187173..3187547 | + | 375 | WP_000854815.1 | type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA | Toxin |
N7219_RS16055 (3187544) | 3187544..3187738 | + | 195 | WP_000988600.1 | DUF5983 family protein | - |
N7219_RS16060 (3187784) | 3187784..3187864 | + | 81 | Protein_3155 | hypothetical protein | - |
N7219_RS16065 (3188153) | 3188153..3188233 | - | 81 | WP_023441679.1 | hypothetical protein | - |
N7219_RS16070 (3188212) | 3188212..3188535 | + | 324 | WP_225469267.1 | EutP/PduV family microcompartment system protein | - |
N7219_RS16075 (3188636) | 3188636..3188965 | - | 330 | WP_000450409.1 | DUF496 family protein | - |
N7219_RS16080 (3189137) | 3189137..3190195 | - | 1059 | WP_001200889.1 | FUSC family protein | - |
N7219_RS16085 (3190393) | 3190393..3190866 | - | 474 | WP_001105368.1 | DNA gyrase inhibitor SbmC | - |
N7219_RS16090 (3190985) | 3190985..3192151 | - | 1167 | WP_001296209.1 | serine-type D-Ala-D-Ala carboxypeptidase DacD | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
No matching records found |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13829.83 Da Isoelectric Point: 7.1326
>T259272 WP_000854815.1 NZ_CP104846:3187173-3187547 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTSDNYRTVNNITLGKYPEAK
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTSDNYRTVNNITLGKYPEAK
Download Length: 375 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13811.70 Da Isoelectric Point: 6.4767
>AT259272 WP_001280918.1 NZ_CP104846:3186716-3187084 [Escherichia coli]
VSDKLHETNYPDDHNDRLWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN
VSDKLHETNYPDDHNDRLWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN
Download Length: 369 bp
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A066T988 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A061Y7A8 |