Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-Phd
Location 1026666..1027267 Replicon chromosome
Accession NZ_CP104846
Organism Escherichia coli strain DFS.1

Toxin (Protein)


Gene name doc Uniprot ID V0AJ64
Locus tag N7219_RS05050 Protein ID WP_001216034.1
Coordinates 1026666..1027046 (-) Length 127 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID U9YQH9
Locus tag N7219_RS05055 Protein ID WP_001190712.1
Coordinates 1027046..1027267 (-) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N7219_RS05015 (1021717) 1021717..1022649 - 933 WP_000081352.1 homocysteine S-methyltransferase -
N7219_RS05020 (1022636) 1022636..1024039 - 1404 WP_001373486.1 S-methylmethionine permease -
N7219_RS05025 (1024283) 1024283..1025263 + 981 WP_000019407.1 IS5-like element IS5 family transposase -
N7219_RS05030 (1025473) 1025473..1025808 + 336 WP_169329198.1 type I deoxyribonuclease HsdR -
N7219_RS05035 (1025758) 1025758..1026171 - 414 Protein_990 integrase core domain-containing protein -
N7219_RS05040 (1026176) 1026176..1026454 - 279 Protein_991 pdcB -
N7219_RS05045 (1026482) 1026482..1026661 - 180 WP_001513661.1 hypothetical protein -
N7219_RS05050 (1026666) 1026666..1027046 - 381 WP_001216034.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
N7219_RS05055 (1027046) 1027046..1027267 - 222 WP_001190712.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
N7219_RS05060 (1027450) 1027450..1027566 + 117 Protein_995 type I restriction endonuclease subunit M -
N7219_RS05065 (1027622) 1027622..1028319 + 698 WP_103215986.1 IS1-like element IS1A family transposase -
N7219_RS05070 (1028401) 1028401..1028838 + 438 WP_001220296.1 tripartite tricarboxylate transporter TctB family protein -
N7219_RS05075 (1028848) 1028848..1030335 + 1488 WP_000353207.1 tripartite tricarboxylate transporter permease -
N7219_RS05080 (1030519) 1030519..1031283 + 765 WP_001148411.1 DedA family protein -
N7219_RS05085 (1031397) 1031397..1032095 - 699 WP_000916271.1 thiamine ABC transporter ATP-binding protein ThiQ -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1019566..1030335 10769
- inside IScluster/Tn - - 1020566..1028319 7753


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(2-123)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-51)


Sequences

Toxin        


Download         Length: 127 a.a.        Molecular weight: 13615.32 Da        Isoelectric Point: 5.1514

>T259259 WP_001216034.1 NZ_CP104846:c1027046-1026666 [Escherichia coli]
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE

Download         Length: 381 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8133.10 Da        Isoelectric Point: 4.7708

>AT259259 WP_001190712.1 NZ_CP104846:c1027267-1027046 [Escherichia coli]
MQSINFRTARGNLSEVLNNVEAGEEVEITRRGREPAVIVSKATFEAYKKAALDAEFASLFDTLDSTNKELVNR

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB V0AJ64

Antitoxin

Source ID Structure
AlphaFold DB A0A829CJB6

References