Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 997229..997749 Replicon chromosome
Accession NZ_CP104846
Organism Escherichia coli strain DFS.1

Toxin (Protein)


Gene name ccdB Uniprot ID A0A061KX66
Locus tag N7219_RS04915 Protein ID WP_001160964.1
Coordinates 997465..997749 (+) Length 95 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID V0VEX8
Locus tag N7219_RS04910 Protein ID WP_000125566.1
Coordinates 997229..997462 (+) Length 78 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N7219_RS04885 (992302) 992302..992589 + 288 WP_000203744.1 ferredoxin-like protein FixX -
N7219_RS04890 (992648) 992648..993979 + 1332 WP_001183209.1 MFS transporter -
N7219_RS04895 (994087) 994087..994617 + 531 WP_000600725.1 glutathione-regulated potassium-efflux system oxidoreductase KefF -
N7219_RS04900 (994610) 994610..996472 + 1863 WP_000377106.1 glutathione-regulated potassium-efflux system protein KefC -
N7219_RS04905 (996664) 996664..997143 + 480 WP_137534363.1 type 3 dihydrofolate reductase -
N7219_RS04910 (997229) 997229..997462 + 234 WP_000125566.1 type II toxin-antitoxin system CcdA family antitoxin Antitoxin
N7219_RS04915 (997465) 997465..997749 + 285 WP_001160964.1 CcdB family protein Toxin
N7219_RS04920 (997776) 997776..998624 - 849 WP_000257181.1 bis(5'-nucleosyl)-tetraphosphatase (symmetrical) ApaH -
N7219_RS04925 (998631) 998631..999008 - 378 WP_000610901.1 Co2+/Mg2+ efflux protein ApaG -
N7219_RS04930 (999011) 999011..999832 - 822 WP_001065365.1 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA -
N7219_RS04935 (999829) 999829..1000818 - 990 WP_000241227.1 4-hydroxythreonine-4-phosphate dehydrogenase PdxA -
N7219_RS04940 (1000818) 1000818..1002104 - 1287 WP_000800457.1 peptidylprolyl isomerase SurA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-93)

Antitoxin

Post-segregation antitoxin CcdA

(8-77)


Sequences

Toxin        


Download         Length: 95 a.a.        Molecular weight: 10692.54 Da        Isoelectric Point: 10.3030

>T259258 WP_001160964.1 NZ_CP104846:997465-997749 [Escherichia coli]
MQFTVYRSRGRNAAFPFVIDVTSDIIGEINRRIVIPLTPIERFSRIRPPERLNPILLLIDGKEYVLMTHETATVPVNALG
TKFCDASAHRTLIK

Download         Length: 285 bp

Antitoxin


Download         Length: 78 a.a.        Molecular weight: 8530.53 Da        Isoelectric Point: 5.8062

>AT259258 WP_000125566.1 NZ_CP104846:997229-997462 [Escherichia coli]
MTAKRTTQSVTVTVDRELVNRARDAGLNMSATLTVALNAELKKHAATRWREENAEAIAALNQLADETGCFSDEYRSF

Download         Length: 234 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A061KX66

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9LTM9

References