Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ataRT/DUF1778(antitoxin) |
| Location | 289697..290497 | Replicon | chromosome |
| Accession | NZ_CP104846 | ||
| Organism | Escherichia coli strain DFS.1 | ||
Toxin (Protein)
| Gene name | ataT | Uniprot ID | F4T503 |
| Locus tag | N7219_RS01345 | Protein ID | WP_000342452.1 |
| Coordinates | 289970..290497 (+) | Length | 176 a.a. |
Antitoxin (Protein)
| Gene name | ataR | Uniprot ID | F4T504 |
| Locus tag | N7219_RS01340 | Protein ID | WP_001277107.1 |
| Coordinates | 289697..289963 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N7219_RS01320 (285356) | 285356..286024 | + | 669 | WP_000617723.1 | cell division ATP-binding protein FtsE | - |
| N7219_RS01325 (286017) | 286017..287075 | + | 1059 | WP_001042013.1 | permease-like cell division protein FtsX | - |
| N7219_RS01330 (287320) | 287320..288174 | + | 855 | WP_000130217.1 | RNA polymerase sigma factor RpoH | - |
| N7219_RS01335 (288445) | 288445..289548 | + | 1104 | WP_001021994.1 | branched chain amino acid ABC transporter substrate-binding protein LivJ | - |
| N7219_RS01340 (289697) | 289697..289963 | + | 267 | WP_001277107.1 | type II toxin-antitoxin system antitoxin AtaR | Antitoxin |
| N7219_RS01345 (289970) | 289970..290497 | + | 528 | WP_000342452.1 | type II toxin-antitoxin system toxin acetyltransferase AtaT | Toxin |
| N7219_RS01350 (290494) | 290494..290877 | - | 384 | WP_000778796.1 | aspartate 1-decarboxylase autocleavage activator PanM | - |
| N7219_RS01355 (291300) | 291300..292409 | + | 1110 | WP_001296485.1 | high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK | - |
| N7219_RS01360 (292457) | 292457..293383 | + | 927 | WP_001295097.1 | high-affinity branched-chain amino acid ABC transporter permease LivH | - |
| N7219_RS01365 (293380) | 293380..294657 | + | 1278 | WP_000803819.1 | branched chain amino acid ABC transporter permease LivM | - |
| N7219_RS01370 (294654) | 294654..295421 | + | 768 | WP_000082099.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 176 a.a. Molecular weight: 19673.57 Da Isoelectric Point: 6.6348
>T259254 WP_000342452.1 NZ_CP104846:289970-290497 [Escherichia coli]
MDDLTIEILTDDADYDLQRFDCGEEALNLFLTTHLVRQHRNKILRAYILCRNTPERQVLGYYTLSGSCFERAALPSKSKQ
KKIPYKNIPSVTLGRLAIDRSLQGQGWGATLVAHAMKVVWSASLAVGIHGLFVEALNEKAHTFYQSLGFIPLVGENENAL
FFPTKSIELLFTPDD
MDDLTIEILTDDADYDLQRFDCGEEALNLFLTTHLVRQHRNKILRAYILCRNTPERQVLGYYTLSGSCFERAALPSKSKQ
KKIPYKNIPSVTLGRLAIDRSLQGQGWGATLVAHAMKVVWSASLAVGIHGLFVEALNEKAHTFYQSLGFIPLVGENENAL
FFPTKSIELLFTPDD
Download Length: 528 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A061K5K9 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A061YQ57 |