Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 86241..86884 Replicon plasmid unnamed2
Accession NZ_CP104845
Organism Escherichia coli strain DFL.5

Toxin (Protein)


Gene name vagD Uniprot ID V0UN72
Locus tag N7217_RS25805 Protein ID WP_001034044.1
Coordinates 86468..86884 (+) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID B1P7N7
Locus tag N7217_RS25800 Protein ID WP_001261286.1
Coordinates 86241..86471 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N7217_RS25775 (82647) 82647..82886 + 240 Protein_101 TraX family protein -
N7217_RS25785 (84281) 84281..85087 - 807 WP_021517370.1 site-specific integrase -
N7217_RS25790 (85088) 85088..85393 - 306 WP_001159871.1 type II toxin-antitoxin system toxin CcdB -
N7217_RS25795 (85395) 85395..85613 - 219 WP_000813630.1 type II toxin-antitoxin system antitoxin CcdA -
N7217_RS25800 (86241) 86241..86471 + 231 WP_001261286.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
N7217_RS25805 (86468) 86468..86884 + 417 WP_001034044.1 type II toxin-antitoxin system VapC family toxin Toxin
N7217_RS25810 (86959) 86959..88524 + 1566 WP_021517369.1 AAA family ATPase -
N7217_RS25815 (88509) 88509..89531 + 1023 WP_000361402.1 helicase UvrD -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid sul1 / aadA2 / dfrA12 / aac(3)-IId / blaTEM-1B / sitABCD / mph(A) iutA / iucD / iucC / iucB / iucA / afaF-III / draA / draB / afaC-I / draD / draP 1..140749 140749
- flank IS/Tn - - 89785..90162 377


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-52)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15232.66 Da        Isoelectric Point: 6.8536

>T259253 WP_001034044.1 NZ_CP104845:86468-86884 [Escherichia coli]
VNKIYMLDTNICSFIMREQPEALLKHLEQSVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCERLDAVLPWDRA
AVDATTEIKVALRLAGTPIGPNDTAIAGHAIAACAILVTNNVREFERVPGLVLEDWVR

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8747.86 Da        Isoelectric Point: 4.3775

>AT259253 WP_001261286.1 NZ_CP104845:86241-86471 [Escherichia coli]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFLELEKADPDFMTEREDVVSDEGRVNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CHW1

Antitoxin

Source ID Structure
AlphaFold DB A0A829CKZ6

References