Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 4505004..4505839 | Replicon | chromosome |
| Accession | NZ_CP104843 | ||
| Organism | Escherichia coli strain DFL.5 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A1C0Y405 |
| Locus tag | N7217_RS21865 | Protein ID | WP_001774607.1 |
| Coordinates | 4505462..4505839 (+) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A1M2U6P5 |
| Locus tag | N7217_RS21860 | Protein ID | WP_001774606.1 |
| Coordinates | 4505004..4505372 (+) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N7217_RS21820 (4500036) | 4500036..4500716 | + | 681 | WP_032082725.1 | WYL domain-containing protein | - |
| N7217_RS21825 (4500864) | 4500864..4501541 | + | 678 | WP_113976222.1 | hypothetical protein | - |
| N7217_RS21830 (4501547) | 4501547..4501780 | + | 234 | WP_001278287.1 | DUF905 family protein | - |
| N7217_RS21835 (4501879) | 4501879..4502697 | + | 819 | WP_016238867.1 | DUF932 domain-containing protein | - |
| N7217_RS21840 (4503036) | 4503036..4503515 | + | 480 | WP_032152717.1 | antirestriction protein | - |
| N7217_RS21845 (4503531) | 4503531..4504007 | + | 477 | WP_001297237.1 | RadC family protein | - |
| N7217_RS21850 (4504070) | 4504070..4504291 | + | 222 | WP_000692312.1 | DUF987 domain-containing protein | - |
| N7217_RS21855 (4504310) | 4504310..4504954 | + | 645 | WP_001774605.1 | hypothetical protein | - |
| N7217_RS21860 (4505004) | 4505004..4505372 | + | 369 | WP_001774606.1 | type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA | Antitoxin |
| N7217_RS21865 (4505462) | 4505462..4505839 | + | 378 | WP_001774607.1 | TA system toxin CbtA family protein | Toxin |
| N7217_RS21870 (4505836) | 4505836..4506324 | + | 489 | WP_001774608.1 | DUF5983 family protein | - |
| N7217_RS21875 (4506336) | 4506336..4506533 | + | 198 | WP_032152719.1 | DUF957 domain-containing protein | - |
| N7217_RS21880 (4506618) | 4506618..4507460 | + | 843 | WP_040235333.1 | DUF4942 domain-containing protein | - |
| N7217_RS21885 (4508209) | 4508209..4509747 | + | 1539 | WP_023908864.1 | lysine decarboxylation/transport transcriptional activator CadC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 4481301..4517560 | 36259 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14218.20 Da Isoelectric Point: 7.8045
>T259247 WP_001774607.1 NZ_CP104843:4505462-4505839 [Escherichia coli]
MKTLPDTHVREASRCPPPVTIWQTLLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDTVNFLVEKYALIRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITQGKHPEAKQ
MKTLPDTHVREASRCPPPVTIWQTLLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDTVNFLVEKYALIRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITQGKHPEAKQ
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13593.31 Da Isoelectric Point: 5.8746
>AT259247 WP_001774606.1 NZ_CP104843:4505004-4505372 [Escherichia coli]
VSDTLSGTTHPDDNHDRPWWGLPCTVTPCFGARLVQEGNQLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPEMKN
VSDTLSGTTHPDDNHDRPWWGLPCTVTPCFGARLVQEGNQLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPEMKN
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1C0Y405 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1M2U6P5 |