Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 4132374..4132924 Replicon chromosome
Accession NZ_CP104843
Organism Escherichia coli strain DFL.5

Toxin (Protein)


Gene name ccdB Uniprot ID S1PDG4
Locus tag N7217_RS20010 Protein ID WP_001160966.1
Coordinates 4132374..4132688 (-) Length 105 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID S1NMQ0
Locus tag N7217_RS20015 Protein ID WP_000125568.1
Coordinates 4132691..4132924 (-) Length 78 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N7217_RS19985 (4128049) 4128049..4129335 + 1287 WP_000800457.1 peptidylprolyl isomerase SurA -
N7217_RS19990 (4129335) 4129335..4130324 + 990 WP_000241224.1 4-hydroxythreonine-4-phosphate dehydrogenase PdxA -
N7217_RS19995 (4130321) 4130321..4131142 + 822 WP_001065381.1 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA -
N7217_RS20000 (4131145) 4131145..4131522 + 378 WP_000610901.1 Co2+/Mg2+ efflux protein ApaG -
N7217_RS20005 (4131529) 4131529..4132377 + 849 WP_000257195.1 bis(5'-nucleosyl)-tetraphosphatase (symmetrical) ApaH -
N7217_RS20010 (4132374) 4132374..4132688 - 315 WP_001160966.1 CcdB family protein Toxin
N7217_RS20015 (4132691) 4132691..4132924 - 234 WP_000125568.1 type II toxin-antitoxin system CcdA family antitoxin Antitoxin
N7217_RS20020 (4133010) 4133010..4133489 - 480 WP_000624375.1 type 3 dihydrofolate reductase -
N7217_RS20025 (4133680) 4133680..4135542 - 1863 WP_022645165.1 glutathione-regulated potassium-efflux system protein KefC -
N7217_RS20030 (4135535) 4135535..4136065 - 531 WP_000600732.1 glutathione-regulated potassium-efflux system oxidoreductase KefF -
N7217_RS20035 (4136173) 4136173..4137504 - 1332 WP_001183201.1 MFS transporter -
N7217_RS20040 (4137562) 4137562..4137849 - 288 WP_000203741.1 ferredoxin-like protein FixX -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-103)

Antitoxin

Post-segregation antitoxin CcdA

(8-77)


Sequences

Toxin        


Download         Length: 105 a.a.        Molecular weight: 11711.72 Da        Isoelectric Point: 9.0851

>T259244 WP_001160966.1 NZ_CP104843:c4132688-4132374 [Escherichia coli]
MQFTVYRSRGRNAAFPFVIDVTSDIIGEINRRIVIPLTPIERFSRIRPPERLNPILLLVDGKEYVLMTHETATVPVNALG
TKFCDASAHRTLIKGALDFMLDGI

Download         Length: 315 bp

Antitoxin


Download         Length: 78 a.a.        Molecular weight: 8560.55 Da        Isoelectric Point: 5.8062

>AT259244 WP_000125568.1 NZ_CP104843:c4132924-4132691 [Escherichia coli]
MTAKRTTQSVTVTVDRELVNRARDAGLNMSATLTVALNAELKKHAATRWREENTEAIAALNQLADETGCFSDEYRSF

Download         Length: 234 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829G815

Antitoxin

Source ID Structure
AlphaFold DB A0A829GEF2

References