Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3735955..3736573 | Replicon | chromosome |
| Accession | NZ_CP104843 | ||
| Organism | Escherichia coli strain DFL.5 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | H5UYE2 |
| Locus tag | N7217_RS18135 | Protein ID | WP_001291435.1 |
| Coordinates | 3736355..3736573 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | S1PTH5 |
| Locus tag | N7217_RS18130 | Protein ID | WP_000344800.1 |
| Coordinates | 3735955..3736329 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N7217_RS18120 (3731044) | 3731044..3732237 | + | 1194 | WP_001295833.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| N7217_RS18125 (3732260) | 3732260..3735409 | + | 3150 | WP_001132469.1 | efflux RND transporter permease AcrB | - |
| N7217_RS18130 (3735955) | 3735955..3736329 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
| N7217_RS18135 (3736355) | 3736355..3736573 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
| N7217_RS18140 (3736745) | 3736745..3737296 | + | 552 | WP_000102574.1 | maltose O-acetyltransferase | - |
| N7217_RS18145 (3737412) | 3737412..3737882 | + | 471 | WP_022645280.1 | YlaC family protein | - |
| N7217_RS18150 (3738046) | 3738046..3739596 | + | 1551 | WP_022645279.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
| N7217_RS18155 (3739638) | 3739638..3739991 | - | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
| N7217_RS18165 (3740370) | 3740370..3740681 | + | 312 | WP_000409911.1 | MGMT family protein | - |
| N7217_RS18170 (3740712) | 3740712..3741284 | - | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T259242 WP_001291435.1 NZ_CP104843:3736355-3736573 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT259242 WP_000344800.1 NZ_CP104843:3735955-3736329 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 2MW2 | |
| PDB | 1JW2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9QBQ5 |