Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RelE-HTH_XRE |
Location | 3294023..3294728 | Replicon | chromosome |
Accession | NZ_CP104843 | ||
Organism | Escherichia coli strain DFL.5 |
Toxin (Protein)
Gene name | relE | Uniprot ID | S1F406 |
Locus tag | N7217_RS15945 | Protein ID | WP_000539521.1 |
Coordinates | 3294023..3294409 (+) | Length | 129 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | N7217_RS15950 | Protein ID | WP_001280945.1 |
Coordinates | 3294399..3294728 (+) | Length | 110 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N7217_RS15925 (3290027) | 3290027..3290653 | + | 627 | WP_001295292.1 | glutathione S-transferase GstB | - |
N7217_RS15930 (3290650) | 3290650..3291765 | - | 1116 | WP_000554964.1 | aldose sugar dehydrogenase YliI | - |
N7217_RS15935 (3291876) | 3291876..3292259 | - | 384 | WP_000497137.1 | biofilm formation regulator BssR | - |
N7217_RS15940 (3292472) | 3292472..3293797 | + | 1326 | WP_000049367.1 | 30S ribosomal protein S12 methylthiotransferase RimO | - |
N7217_RS15945 (3294023) | 3294023..3294409 | + | 387 | WP_000539521.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
N7217_RS15950 (3294399) | 3294399..3294728 | + | 330 | WP_001280945.1 | DNA-binding transcriptional regulator | Antitoxin |
N7217_RS15955 (3294798) | 3294798..3296126 | - | 1329 | WP_022645414.1 | GGDEF domain-containing protein | - |
N7217_RS15960 (3296134) | 3296134..3298482 | - | 2349 | WP_022645413.1 | EAL domain-containing protein | - |
N7217_RS15965 (3298659) | 3298659..3299570 | - | 912 | WP_001236044.1 | glutathione ABC transporter permease GsiD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 14293.45 Da Isoelectric Point: 9.9296
>T259240 WP_000539521.1 NZ_CP104843:3294023-3294409 [Escherichia coli]
MGVYKARRFSQSTKKLGIHDKVLMAAAEEVMQGIWEADLGSGVIKKRLPLQQGKSGGARTIIFFKSANHVFFYDGWSKSG
LSSKGTKEIEDDELAAYKKMANAFLAFSNKQIEDLIETGFLIEVKNER
MGVYKARRFSQSTKKLGIHDKVLMAAAEEVMQGIWEADLGSGVIKKRLPLQQGKSGGARTIIFFKSANHVFFYDGWSKSG
LSSKGTKEIEDDELAAYKKMANAFLAFSNKQIEDLIETGFLIEVKNER
Download Length: 387 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|