Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 3037857..3038641 | Replicon | chromosome |
Accession | NZ_CP104843 | ||
Organism | Escherichia coli strain DFL.5 |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | V0T0H9 |
Locus tag | N7217_RS14725 | Protein ID | WP_000613626.1 |
Coordinates | 3038147..3038641 (+) | Length | 165 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | A0A0A1AEM7 |
Locus tag | N7217_RS14720 | Protein ID | WP_024946541.1 |
Coordinates | 3037857..3038150 (+) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N7217_RS14710 (3033018) | 3033018..3033977 | - | 960 | WP_022645527.1 | 23S rRNA pseudouridine(955/2504/2580) synthase RluC | - |
N7217_RS14715 (3034550) | 3034550..3037723 | + | 3174 | WP_022645526.1 | ribonuclease E | - |
N7217_RS14720 (3037857) | 3037857..3038150 | + | 294 | WP_024946541.1 | DUF1778 domain-containing protein | Antitoxin |
N7217_RS14725 (3038147) | 3038147..3038641 | + | 495 | WP_000613626.1 | GNAT family N-acetyltransferase | Toxin |
N7217_RS14730 (3038736) | 3038736..3039689 | - | 954 | WP_022645524.1 | flagellar hook-associated protein FlgL | - |
N7217_RS14735 (3039701) | 3039701..3041344 | - | 1644 | WP_022645523.1 | flagellar hook-associated protein FlgK | - |
N7217_RS14740 (3041410) | 3041410..3042351 | - | 942 | WP_001317765.1 | flagellar assembly peptidoglycan hydrolase FlgJ | - |
N7217_RS14745 (3042351) | 3042351..3043448 | - | 1098 | WP_021580666.1 | flagellar basal body P-ring protein FlgI | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 165 a.a. Molecular weight: 18084.00 Da Isoelectric Point: 8.2617
>T259239 WP_000613626.1 NZ_CP104843:3038147-3038641 [Escherichia coli]
MIQAPEPLMARHQFTSFCSGVETMDNWLKQRALKNQLAGASRTFVSCDTYSNVLAYYSLASSAVETYVATGRFRRNMPEP
IPVVVLGRLAIDKSLQGQGIGRAMVRDAGLRVLQAAEVIGIRGMLVHALSDQAREFYLRVGFEPSPVDSMILMATLADLQ
ECLK
MIQAPEPLMARHQFTSFCSGVETMDNWLKQRALKNQLAGASRTFVSCDTYSNVLAYYSLASSAVETYVATGRFRRNMPEP
IPVVVLGRLAIDKSLQGQGIGRAMVRDAGLRVLQAAEVIGIRGMLVHALSDQAREFYLRVGFEPSPVDSMILMATLADLQ
ECLK
Download Length: 495 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | V0T0H9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0A1AEM7 |