Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
Location | 2637429..2638067 | Replicon | chromosome |
Accession | NZ_CP104843 | ||
Organism | Escherichia coli strain DFL.5 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | S1F9G9 |
Locus tag | N7217_RS12720 | Protein ID | WP_000813794.1 |
Coordinates | 2637891..2638067 (-) | Length | 59 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | N7217_RS12715 | Protein ID | WP_001270286.1 |
Coordinates | 2637429..2637845 (-) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N7217_RS12695 (2632581) | 2632581..2633522 | - | 942 | WP_022645667.1 | ABC transporter permease | - |
N7217_RS12700 (2633523) | 2633523..2634536 | - | 1014 | WP_022645666.1 | ABC transporter ATP-binding protein | - |
N7217_RS12705 (2634554) | 2634554..2635699 | - | 1146 | WP_000047466.1 | ABC transporter substrate-binding protein | - |
N7217_RS12710 (2635944) | 2635944..2637350 | - | 1407 | WP_022645665.1 | PLP-dependent aminotransferase family protein | - |
N7217_RS12715 (2637429) | 2637429..2637845 | - | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
N7217_RS12720 (2637891) | 2637891..2638067 | - | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
N7217_RS12725 (2638289) | 2638289..2638519 | + | 231 | WP_000491567.1 | DUF2554 family protein | - |
N7217_RS12730 (2638611) | 2638611..2640572 | - | 1962 | WP_023909195.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
N7217_RS12735 (2640645) | 2640645..2641181 | - | 537 | WP_000429148.1 | DNA-binding transcriptional regulator SutR | - |
N7217_RS12740 (2641234) | 2641234..2642445 | + | 1212 | WP_071788120.1 | BenE family transporter YdcO | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T259238 WP_000813794.1 NZ_CP104843:c2638067-2637891 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT259238 WP_001270286.1 NZ_CP104843:c2637845-2637429 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|