Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 836164..836999 Replicon chromosome
Accession NZ_CP104843
Organism Escherichia coli strain DFL.5

Toxin (Protein)


Gene name yeeV Uniprot ID A0A0A1A9A5
Locus tag N7217_RS04020 Protein ID WP_001564063.1
Coordinates 836164..836541 (-) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A0A1AEL8
Locus tag N7217_RS04025 Protein ID WP_038432125.1
Coordinates 836631..836999 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N7217_RS03990 (832748) 832748..833524 + 777 WP_000124279.1 ABC transporter permease -
N7217_RS03995 (833521) 833521..834189 + 669 WP_021523268.1 ABC transporter ATP-binding protein -
N7217_RS04000 (834240) 834240..834937 + 698 WP_223814698.1 IS1 family transposase -
N7217_RS04005 (834953) 834953..835660 - 708 Protein_787 DUF4942 domain-containing protein -
N7217_RS04010 (835745) 835745..835939 - 195 WP_024181941.1 DUF957 domain-containing protein -
N7217_RS04015 (836018) 836018..836167 - 150 Protein_789 DUF5983 family protein -
N7217_RS04020 (836164) 836164..836541 - 378 WP_001564063.1 TA system toxin CbtA family protein Toxin
N7217_RS04025 (836631) 836631..836999 - 369 WP_038432125.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
N7217_RS04030 (837162) 837162..837383 - 222 WP_000692345.1 DUF987 domain-containing protein -
N7217_RS04035 (837448) 837448..837924 - 477 WP_021553055.1 RadC family protein -
N7217_RS04040 (837940) 837940..838419 - 480 WP_001564060.1 antirestriction protein -
N7217_RS04045 (838519) 838519..838659 + 141 WP_000997937.1 hypothetical protein -
N7217_RS04050 (838685) 838685..839503 - 819 WP_001175165.1 DUF932 domain-containing protein -
N7217_RS04055 (839593) 839593..839826 - 234 WP_001278293.1 DUF905 family protein -
N7217_RS04060 (839832) 839832..840509 - 678 WP_001564058.1 hypothetical protein -
N7217_RS04065 (840660) 840660..841340 - 681 WP_001278649.1 WYL domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - kpsM / kpsT 832748..870825 38077


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14094.09 Da        Isoelectric Point: 7.8045

>T259231 WP_001564063.1 NZ_CP104843:c836541-836164 [Escherichia coli]
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYSLTLNDTPFVDERVIEQHIEAGISLCDAVNFLVEKYVLVRTDQPGF
SAGASSQLINSIDILRARRATGLMTRSNYRTVNNITRGKHPEAKQ

Download         Length: 378 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13569.31 Da        Isoelectric Point: 7.0369

>AT259231 WP_038432125.1 NZ_CP104843:c836999-836631 [Escherichia coli]
VSDTLSGTTHPDDNHDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGNRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSGGYVYLAVYPTPETKK

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0A1A9A5

Antitoxin

Source ID Structure
AlphaFold DB A0A0A1AEL8

References