Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/HicA-HicB |
Location | 166886..167498 | Replicon | chromosome |
Accession | NZ_CP104843 | ||
Organism | Escherichia coli strain DFL.5 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | U9YXE2 |
Locus tag | N7217_RS00730 | Protein ID | WP_000833473.1 |
Coordinates | 166886..167071 (+) | Length | 62 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | A0A0A1AGA0 |
Locus tag | N7217_RS00735 | Protein ID | WP_022646255.1 |
Coordinates | 167088..167498 (+) | Length | 137 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N7217_RS00715 (162352) | 162352..163647 | + | 1296 | WP_000985736.1 | Fic family protein | - |
N7217_RS00720 (163755) | 163755..165293 | + | 1539 | WP_000183976.1 | aldehyde dehydrogenase AldB | - |
N7217_RS00725 (165334) | 165334..166413 | - | 1080 | WP_000061477.1 | type I restriction enzyme HsdR N-terminal domain-containing protein | - |
N7217_RS00730 (166886) | 166886..167071 | + | 186 | WP_000833473.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
N7217_RS00735 (167088) | 167088..167498 | + | 411 | WP_022646255.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
N7217_RS00740 (167610) | 167610..169589 | - | 1980 | WP_022646254.1 | glycoside hydrolase family 127 protein | - |
N7217_RS00745 (169600) | 169600..171000 | - | 1401 | WP_001600688.1 | MFS transporter | - |
N7217_RS00750 (171226) | 171226..172041 | + | 816 | WP_022646253.1 | AraC family transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 62 a.a. Molecular weight: 6800.89 Da Isoelectric Point: 11.7053
>T259229 WP_000833473.1 NZ_CP104843:166886-167071 [Escherichia coli]
VKSADVIAILKQHGWEHIRTRGSHHQFRHPVHPGLVTVPHPKKDIKPGTLAQIGRQAGLTF
VKSADVIAILKQHGWEHIRTRGSHHQFRHPVHPGLVTVPHPKKDIKPGTLAQIGRQAGLTF
Download Length: 186 bp
Antitoxin
Download Length: 137 a.a. Molecular weight: 15214.08 Da Isoelectric Point: 4.4482
>AT259229 WP_022646255.1 NZ_CP104843:167088-167498 [Escherichia coli]
MFYPAYIHSDPDGSASGFFPDVPGCYFAGDTLDNAFQDARSALAAHFETLCEMDEELPLPGSVETHLVQRAQDFIGGQWL
LVDINMNQFEGRAERINITMPKRLLNKIDTYVRNNPDYANRSAFLAEAARRVLPGV
MFYPAYIHSDPDGSASGFFPDVPGCYFAGDTLDNAFQDARSALAAHFETLCEMDEELPLPGSVETHLVQRAQDFIGGQWL
LVDINMNQFEGRAERINITMPKRLLNKIDTYVRNNPDYANRSAFLAEAARRVLPGV
Download Length: 411 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | U9YXE2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0A1AGA0 |