Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 207810..208360 Replicon plasmid unnamed5
Accession NZ_CP104841
Organism Enterobacter cloacae strain 2022CK-00409

Toxin (Protein)


Gene name ccdB Uniprot ID S1EZ93
Locus tag N7S94_RS27185 Protein ID WP_007372286.1
Coordinates 207810..208118 (-) Length 103 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID S1FMC3
Locus tag N7S94_RS27190 Protein ID WP_007372285.1
Coordinates 208121..208360 (-) Length 80 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N7S94_RS27140 (N7S94_27135) 202892..203335 - 444 WP_007372295.1 hypothetical protein -
N7S94_RS27145 (N7S94_27140) 203573..203911 + 339 WP_007372294.1 hypothetical protein -
N7S94_RS27150 (N7S94_27145) 204274..204600 - 327 WP_007372293.1 hypothetical protein -
N7S94_RS27155 (N7S94_27150) 204684..205082 - 399 WP_007372292.1 hypothetical protein -
N7S94_RS27160 (N7S94_27155) 205093..205380 - 288 WP_016241556.1 hypothetical protein -
N7S94_RS27165 (N7S94_27160) 205682..206152 - 471 WP_007372290.1 HAD domain-containing protein -
N7S94_RS27170 (N7S94_27165) 206235..206852 - 618 WP_007372289.1 hypothetical protein -
N7S94_RS27175 (N7S94_27170) 206922..207476 - 555 WP_007372288.1 hypothetical protein -
N7S94_RS27180 (N7S94_27175) 207631..207789 - 159 WP_016241558.1 hypothetical protein -
N7S94_RS27185 (N7S94_27180) 207810..208118 - 309 WP_007372286.1 CcdB family protein Toxin
N7S94_RS27190 (N7S94_27185) 208121..208360 - 240 WP_007372285.1 type II toxin-antitoxin system CcdA family antitoxin Antitoxin
N7S94_RS27195 (N7S94_27190) 208499..208963 - 465 WP_008786596.1 hypothetical protein -
N7S94_RS27200 (N7S94_27195) 208960..209634 - 675 WP_008786597.1 hypothetical protein -
N7S94_RS27205 209685..210095 - 411 WP_016241559.1 hypothetical protein -
N7S94_RS27210 (N7S94_27200) 210092..210724 - 633 WP_007372282.1 hypothetical protein -
N7S94_RS27215 (N7S94_27205) 210740..210880 - 141 WP_007372281.1 hypothetical protein -
N7S94_RS27220 (N7S94_27210) 211028..211486 - 459 WP_008786599.1 hypothetical protein -
N7S94_RS27225 (N7S94_27215) 211539..211736 - 198 WP_032155220.1 Lar family restriction alleviation protein -
N7S94_RS27230 (N7S94_27220) 211759..212454 - 696 WP_007372278.1 hypothetical protein -
N7S94_RS27235 (N7S94_27225) 212585..212776 - 192 WP_016241560.1 hypothetical protein -
N7S94_RS27240 (N7S94_27230) 212958..213353 - 396 WP_024196081.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..318750 318750


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-101)

Antitoxin

Post-segregation antitoxin CcdA

(9-79)


Sequences

Toxin        


Download         Length: 103 a.a.        Molecular weight: 11351.17 Da        Isoelectric Point: 8.5044

>T259227 WP_007372286.1 NZ_CP104841:c208118-207810 [Enterobacter cloacae]
MQYTVYRNPGNSQAYPYLLDIQSDIIGELNTRLVIPLHRLKKGASAPVARLTPVIQVEGNDVILMTHEMASVRVKQLGQA
VMDASPFRHTIKSAVDFLLDGF

Download         Length: 309 bp

Antitoxin


Download         Length: 80 a.a.        Molecular weight: 8784.97 Da        Isoelectric Point: 8.6387

>AT259227 WP_007372285.1 NZ_CP104841:c208360-208121 [Enterobacter cloacae]
MQATAARQKKTVSVTLEPMLVQQAKDAGINLSATLAEALQSKLKASAAEEWKRQNRAGIQELNRITEEHGLLSDEYRTF

Download         Length: 240 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB S1EZ93

Antitoxin

Source ID Structure
AlphaFold DB S1FMC3

References