Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
| Location | 207810..208360 | Replicon | plasmid unnamed5 |
| Accession | NZ_CP104841 | ||
| Organism | Enterobacter cloacae strain 2022CK-00409 | ||
Toxin (Protein)
| Gene name | ccdB | Uniprot ID | S1EZ93 |
| Locus tag | N7S94_RS27185 | Protein ID | WP_007372286.1 |
| Coordinates | 207810..208118 (-) | Length | 103 a.a. |
Antitoxin (Protein)
| Gene name | ccdA | Uniprot ID | S1FMC3 |
| Locus tag | N7S94_RS27190 | Protein ID | WP_007372285.1 |
| Coordinates | 208121..208360 (-) | Length | 80 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N7S94_RS27140 (N7S94_27135) | 202892..203335 | - | 444 | WP_007372295.1 | hypothetical protein | - |
| N7S94_RS27145 (N7S94_27140) | 203573..203911 | + | 339 | WP_007372294.1 | hypothetical protein | - |
| N7S94_RS27150 (N7S94_27145) | 204274..204600 | - | 327 | WP_007372293.1 | hypothetical protein | - |
| N7S94_RS27155 (N7S94_27150) | 204684..205082 | - | 399 | WP_007372292.1 | hypothetical protein | - |
| N7S94_RS27160 (N7S94_27155) | 205093..205380 | - | 288 | WP_016241556.1 | hypothetical protein | - |
| N7S94_RS27165 (N7S94_27160) | 205682..206152 | - | 471 | WP_007372290.1 | HAD domain-containing protein | - |
| N7S94_RS27170 (N7S94_27165) | 206235..206852 | - | 618 | WP_007372289.1 | hypothetical protein | - |
| N7S94_RS27175 (N7S94_27170) | 206922..207476 | - | 555 | WP_007372288.1 | hypothetical protein | - |
| N7S94_RS27180 (N7S94_27175) | 207631..207789 | - | 159 | WP_016241558.1 | hypothetical protein | - |
| N7S94_RS27185 (N7S94_27180) | 207810..208118 | - | 309 | WP_007372286.1 | CcdB family protein | Toxin |
| N7S94_RS27190 (N7S94_27185) | 208121..208360 | - | 240 | WP_007372285.1 | type II toxin-antitoxin system CcdA family antitoxin | Antitoxin |
| N7S94_RS27195 (N7S94_27190) | 208499..208963 | - | 465 | WP_008786596.1 | hypothetical protein | - |
| N7S94_RS27200 (N7S94_27195) | 208960..209634 | - | 675 | WP_008786597.1 | hypothetical protein | - |
| N7S94_RS27205 | 209685..210095 | - | 411 | WP_016241559.1 | hypothetical protein | - |
| N7S94_RS27210 (N7S94_27200) | 210092..210724 | - | 633 | WP_007372282.1 | hypothetical protein | - |
| N7S94_RS27215 (N7S94_27205) | 210740..210880 | - | 141 | WP_007372281.1 | hypothetical protein | - |
| N7S94_RS27220 (N7S94_27210) | 211028..211486 | - | 459 | WP_008786599.1 | hypothetical protein | - |
| N7S94_RS27225 (N7S94_27215) | 211539..211736 | - | 198 | WP_032155220.1 | Lar family restriction alleviation protein | - |
| N7S94_RS27230 (N7S94_27220) | 211759..212454 | - | 696 | WP_007372278.1 | hypothetical protein | - |
| N7S94_RS27235 (N7S94_27225) | 212585..212776 | - | 192 | WP_016241560.1 | hypothetical protein | - |
| N7S94_RS27240 (N7S94_27230) | 212958..213353 | - | 396 | WP_024196081.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..318750 | 318750 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 103 a.a. Molecular weight: 11351.17 Da Isoelectric Point: 8.5044
>T259227 WP_007372286.1 NZ_CP104841:c208118-207810 [Enterobacter cloacae]
MQYTVYRNPGNSQAYPYLLDIQSDIIGELNTRLVIPLHRLKKGASAPVARLTPVIQVEGNDVILMTHEMASVRVKQLGQA
VMDASPFRHTIKSAVDFLLDGF
MQYTVYRNPGNSQAYPYLLDIQSDIIGELNTRLVIPLHRLKKGASAPVARLTPVIQVEGNDVILMTHEMASVRVKQLGQA
VMDASPFRHTIKSAVDFLLDGF
Download Length: 309 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|