Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | /RES-TIGR02293 |
| Location | 200160..201061 | Replicon | plasmid unnamed5 |
| Accession | NZ_CP104841 | ||
| Organism | Enterobacter cloacae strain 2022CK-00409 | ||
Toxin (Protein)
| Gene name | - | Uniprot ID | A0A837LJP8 |
| Locus tag | N7S94_RS27115 | Protein ID | WP_007372300.1 |
| Coordinates | 200603..201061 (+) | Length | 153 a.a. |
Antitoxin (Protein)
| Gene name | - | Uniprot ID | - |
| Locus tag | N7S94_RS27110 | Protein ID | WP_008786588.1 |
| Coordinates | 200160..200606 (+) | Length | 149 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N7S94_RS27085 (N7S94_27080) | 197606..197770 | - | 165 | WP_007372306.1 | hypothetical protein | - |
| N7S94_RS27090 (N7S94_27085) | 198057..198500 | - | 444 | WP_007372305.1 | hypothetical protein | - |
| N7S94_RS27095 (N7S94_27090) | 198560..198838 | - | 279 | WP_007372304.1 | hypothetical protein | - |
| N7S94_RS27100 (N7S94_27095) | 198810..199652 | - | 843 | WP_007372303.1 | hypothetical protein | - |
| N7S94_RS27105 (N7S94_27100) | 199694..200011 | - | 318 | WP_007372302.1 | hypothetical protein | - |
| N7S94_RS27110 (N7S94_27105) | 200160..200606 | + | 447 | WP_008786588.1 | DUF2384 domain-containing protein | Antitoxin |
| N7S94_RS27115 (N7S94_27110) | 200603..201061 | + | 459 | WP_007372300.1 | RES family NAD+ phosphorylase | Toxin |
| N7S94_RS27120 (N7S94_27115) | 201105..201335 | + | 231 | WP_007372299.1 | hypothetical protein | - |
| N7S94_RS27125 (N7S94_27120) | 201403..201669 | - | 267 | WP_007372298.1 | hypothetical protein | - |
| N7S94_RS27130 (N7S94_27125) | 201719..202273 | - | 555 | WP_007372297.1 | hypothetical protein | - |
| N7S94_RS27135 (N7S94_27130) | 202432..202773 | - | 342 | WP_007372296.1 | hypothetical protein | - |
| N7S94_RS27140 (N7S94_27135) | 202892..203335 | - | 444 | WP_007372295.1 | hypothetical protein | - |
| N7S94_RS27145 (N7S94_27140) | 203573..203911 | + | 339 | WP_007372294.1 | hypothetical protein | - |
| N7S94_RS27150 (N7S94_27145) | 204274..204600 | - | 327 | WP_007372293.1 | hypothetical protein | - |
| N7S94_RS27155 (N7S94_27150) | 204684..205082 | - | 399 | WP_007372292.1 | hypothetical protein | - |
| N7S94_RS27160 (N7S94_27155) | 205093..205380 | - | 288 | WP_016241556.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..318750 | 318750 | |
| - | flank | IS/Tn | - | - | 195974..197116 | 1142 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 153 a.a. Molecular weight: 16975.40 Da Isoelectric Point: 4.5730
>T259226 WP_007372300.1 NZ_CP104841:200603-201061 [Enterobacter cloacae]
VILYRLTKTRYLMTAWSGLGAKEAGGRWNSVGTAMVYLSETASLTMLETLVHIHAPQLLDDFTLLSLDVPDDQIQTFDMS
RLPDNWASEDAPAELALYGDNWAESGSSIALRIPSALSPVEFNYLLNPAHPELFDLMATVKKIPFRFDSRLK
VILYRLTKTRYLMTAWSGLGAKEAGGRWNSVGTAMVYLSETASLTMLETLVHIHAPQLLDDFTLLSLDVPDDQIQTFDMS
RLPDNWASEDAPAELALYGDNWAESGSSIALRIPSALSPVEFNYLLNPAHPELFDLMATVKKIPFRFDSRLK
Download Length: 459 bp
Antitoxin
Download Length: 149 a.a. Molecular weight: 16689.02 Da Isoelectric Point: 6.9812
>AT259226 WP_008786588.1 NZ_CP104841:200160-200606 [Enterobacter cloacae]
MTMKVFSPDVTKTNQHCLWQVAGLDNDGIALMDKINHGLDGTVAKHISEWANITPSELRKMSGIPNTTFNRSIKDRFTAD
QSERLVRIIRVIERAVELFEGDKEAAHKWLNEANRGLSWKSPAELVSSETGALEVMRLITRIEHGVYS
MTMKVFSPDVTKTNQHCLWQVAGLDNDGIALMDKINHGLDGTVAKHISEWANITPSELRKMSGIPNTTFNRSIKDRFTAD
QSERLVRIIRVIERAVELFEGDKEAAHKWLNEANRGLSWKSPAELVSSETGALEVMRLITRIEHGVYS
Download Length: 447 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|